KEGG   Colwellia sp. Arc7-D: DBO93_15905Help
Entry
DBO93_15905       CDS       T05422                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
cola  Colwellia sp. Arc7-D
Pathway
cola03030  DNA replication
cola03430  Mismatch repair
cola03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DBO93_15905
   03430 Mismatch repair
    DBO93_15905
   03440 Homologous recombination
    DBO93_15905
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cola03032]
    DBO93_15905
   03400 DNA repair and recombination proteins [BR:cola03400]
    DBO93_15905
Enzymes [BR:cola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DBO93_15905
DNA replication proteins [BR:cola03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     DBO93_15905
DNA repair and recombination proteins [BR:cola03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     DBO93_15905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AWB58894
UniProt: A0A2S0V3V9
LinkDB All DBs
Position
3685580..3686056
Genome map
AA seq 158 aa AA seqDB search
MLTQAMFYSIEEKSTVTGVTDAQLHLHYACLQAAHFYRQNQRVFIYTQDQQSAHDIDEML
WAFDPDSFVPHNLIGEGPKQGAAVEISWQPPKNRRAVLINLTSEVPNFANQFSHLIDFVP
ADDTLKEQARNRFRTCRQWGFNVAHQVASAPQTIDTSS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgctaacccaagcaatgttctacagtatagaagaaaaaagtacagtcacaggtgtaact
gatgcacagttgcacctgcactatgcctgtttgcaagcggctcacttttaccgacaaaat
caacgggtatttatttatactcaagatcaacaaagcgcgcatgatattgacgaaatgtta
tgggcttttgatcctgacagctttgtaccacacaatttaattggtgaaggtccaaagcaa
ggtgctgctgtcgaaataagttggcaaccacccaagaaccgccgagcggttttaattaat
ttaactagcgaggtacccaacttcgctaaccaattttcgcatctaatagattttgtgcct
gccgatgacaccttaaaagaacaagctcgaaaccgttttcgaacttgtcgacaatggggt
tttaatgtagctcaccaagttgcaagcgcaccacaaactattgatacaagcagttaa

DBGET integrated database retrieval system