KEGG   Colwellia sp. Arc7-D: DBO93_16950Help
Entry
DBO93_16950       CDS       T05422                                 

Definition
(GenBank) two-component system response regulator ArcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
cola  Colwellia sp. Arc7-D
Pathway
cola02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DBO93_16950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cola02022]
    DBO93_16950
Two-component system [BR:cola02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   DBO93_16950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AWB59079
UniProt: A0A2S0V4F0
LinkDB All DBs
Position
3909671..3910372
Genome map
AA seq 233 aa AA seqDB search
MQKPHILIVEDEDVTRFNLRNLFEAEGYKVAEAIDGDSMERELQNNVINLVILDINLPGK
NGLLLARELTRNKDLGLIFLTGRDSDIDKVLGLEIGADDYLTKPFNPRELTIRARNILNR
ISSSNAENTGVIVSFNQWSLDGNSRKMTTPDNRVISIPRGEYRALSLLIANAGKIVTRQQ
LIKEMTGRDLRENDRTVDVTIRRLRKHFESVESSPELINTIHGEGYRFIGQVD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacctcacatattaatcgtagaagacgaagacgttacacgctttaatctacga
aatctatttgaagctgaaggctataaagtggctgaagcaatagacggtgatagcatggag
cgcgaactgcaaaacaacgttatcaatttagtgatattagatattaatttgccaggaaag
aacggccttttactcgctcgagaattaacgcgtaataaagacttaggtttaatttttctg
acgggtcgcgacagtgatattgataaagttttaggcctagaaataggtgctgatgattat
ttaactaagccctttaatccacgtgagctaacgattagagcacgaaatatattaaataga
atatcgtcaagcaatgctgaaaatacaggggtcattgtaagttttaatcaatggtctctt
gatggcaactcacgaaaaatgaccactccagataatagagtaatctcgattccacgcggc
gaatatagagcccttagcttgctaatagctaatgcaggaaaaattgttactcgtcagcaa
ttaattaaagaaatgaccggtagagatttacgtgaaaatgaccgaactgttgatgttacc
attcgtcgtcttcgtaaacattttgaatcagttgagagttcacctgaattaatcaacaca
atccacggcgaaggatatcgctttattggccaggttgactaa

DBGET integrated database retrieval system