KEGG   Colwellia sp. PAMC 21821: A3Q33_00935Help
Entry
A3Q33_00935       CDS       T04816                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00071  Fatty acid degradation
colw00362  Benzoate degradation
colw00650  Butanoate metabolism
colw01100  Metabolic pathways
colw01120  Microbial metabolism in diverse environments
colw01200  Carbon metabolism
colw01212  Fatty acid metabolism
Module
colw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:colw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3Q33_00935
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3Q33_00935
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3Q33_00935
Enzymes [BR:colw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A3Q33_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Pyr_redox_2 F420_oxidored Pyr_redox YgbB Methyltransf_12 Ion_trans
Motif
Other DBs
NCBI-ProteinID: ARD43020
UniProt: A0A1V0KMP6
LinkDB All DBs
Position
complement(232832..234931)
Genome map
AA seq 699 aa AA seqDB search
MSVVSYQLEGNIGVIRLNNPPVNALSHALRLGIQSVLAQAKDDESLALVLMCEGRTFIAG
ADISEFGKPPMLPSLPELLNVVEAFTKPIIAAIHGTALGGGLETAMACHYRCALATANVG
LPEVKLGLLPGAGGTQRAPRLVGVKAAMDLITTGVPISADKALSIGLIDKVVEGDLLTSA
IKFAQEVVEQGAVVRRVRDIEVDKESVLDNFFADCRAKLSQRYRHQEGPQRIVECIEAAM
NKPFDEGLKVERRLFIECMNSSQSAALRHMFFAERMSSKIKDLPKDTQLKDIKHVGIIGG
GTMGGGIAMNFVNAGIPVTLLEINDVALQRGKDIIAKNYAMTVKKGKLTAELAVQRQELI
TGTTDYNDLADMDLVIEAVFENLDIKKQVFAKLDNVCKPGAILASNTSYQDVNLIAESTS
RPQDVIGLHFFSPANVMKLLEIVRGEKTSDQVLATSMAIAKTIKKVPALSRVCYGFIGNR
MLRQYAREAQLCLLEGSTPQGIDTVMQNFGMAMGPLAVGDLAGIDIGYKAREGLTDEEKG
DVRTYCIADALYDMGRLGQKTGAGYYQYDPDTRQRMSDPLVLEVIEAQAKQRGVVRKAID
DETILQRLTFALINEGFKILEEGIAQRPSDIDVVYAFGYGFPAYRGGPMFYAESIGLEKI
YQTICEFGETYGEEFWQPAALLKQLVAEGKTLTQWANSQ
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgttagttatcaattagaaggtaatattggtgttattcgtttaaataacccg
ccagttaacgcgctttctcatgccttaaggttaggaattcaatcggtattagcgcaagca
aaagatgatgaatcattagcattagttttgatgtgtgaagggcgtacttttatcgcaggg
gcagacatttcagagttcggtaaaccgcctatgttgccatcgttacctgagctgcttaat
gttgtagaagcatttactaagcctattattgctgccattcatggcacagcacttggtggt
ggtttagaaacagccatggcttgtcactatcgttgtgcattggccacggcgaatgttggt
ttacctgaagttaaattaggtttgttgcctggcgctggtggaacacaaagagcacctagg
ttggtcggtgttaaagccgcaatggacttaattactaccggtgtaccaatttcggcagat
aaagccctgagtatcggcttaattgataaagtagttgaaggcgatttactgacttcagcg
attaagtttgcccaagaagttgttgaacaaggggctgtagttagaagagtaagagatata
gaggttgataaggaaagtgtattagataatttttttgctgattgtagagcgaaattaagt
cagcgatatcggcatcaagaagggcctcaacgtattgttgaatgtattgaagcggctatg
aataaaccttttgatgaaggtcttaaagttgaaaggcgtttatttatagagtgtatgaac
tcatcgcagtctgcggcattacgtcatatgttttttgccgaaagaatgtcctcaaaaatt
aaagatttaccaaaagatactcagctaaaagatattaaacacgtgggcattattggtggc
ggtaccatgggaggaggtattgcaatgaattttgttaatgcgggtatccctgtgacttta
ctggaaattaacgatgtagcattgcagcgtggtaaagatattatcgctaaaaattacgcg
atgacagttaaaaaaggtaaattgactgctgagctcgccgtacaacgccaagagctgatc
acaggcaccacagattataacgacttagctgatatggatttggtgattgaagccgttttt
gaaaacctagacatcaaaaagcaagtattcgctaagcttgataacgtgtgtaaacccggt
gctattttagccagtaacacttcttatcaagacgttaatttaatcgcagagtcaacttct
cgtccacaagatgttattggtctgcatttctttagtcctgctaatgtaatgaaattactt
gaaattgtacgtggtgaaaaaacctctgatcaagtgctagcgacatcgatggcgattgct
aaaaccattaaaaaagtgccggcactgtctcgcgtttgttatggctttattggtaaccgt
atgttgcgtcaatatgcgcgtgaagcccaattatgtttacttgaaggctcaacacctcaa
ggtatagacaccgtaatgcaaaactttggtatggcaatgggaccgctcgctgttggtgat
ttagctgggatagacattggctataaagcgcgtgagggtttaactgatgaagaaaagggg
gatgttagaacctactgcattgctgatgctttatatgacatgggccgtttaggtcaaaaa
accggtgcaggctattaccaatatgatcccgacacaagacagcgtatgtcagacccgcta
gtacttgaggttattgaagcacaagccaagcaaagaggggttgtgcgtaaagcaattgat
gatgaaactattttacaacgtttaacttttgctttgatcaacgagggcttcaaaatactt
gaagaaggtattgcacaacgcccaagtgatattgatgtggtttacgccttcggttatgga
tttccagcttatcgaggtggcccaatgttttatgctgagagcataggtttagaaaaaatc
tatcaaactatatgtgaattcggcgaaacttacggtgaagagttttggcaacctgctgca
ttattaaaacaacttgttgcggaaggtaagaccttaactcaatgggcaaacagccaatag

DBGET integrated database retrieval system