KEGG   Colwellia sp. PAMC 21821: A3Q33_03175
Entry
A3Q33_03175       CDS       T04816                                 

Definition
(GenBank) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:colw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3Q33_03175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:colw01007]
    A3Q33_03175
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:colw03016]
    A3Q33_03175
Enzymes [BR:colw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     A3Q33_03175
Amino acid related enzymes [BR:colw01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   A3Q33_03175
Transfer RNA biogenesis [BR:colw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A3Q33_03175
 Prokaryotic type
    A3Q33_03175
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD RuvB_C
Other DBs
NCBI-ProteinID: ARD43395
UniProt: A0A1V0KNT6
LinkDB
Position
complement(746779..749403)
AA seq 874 aa
MIETSAQLRQAFLDFYASKQHQIVASSSLVPGNDATLLFTNAGMVPFKDVFLGDDVRSYT
RATSAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKEEAINYAWEFLTTVLA
LPKEKLLVTVYESDDEAYNYWLNEIGVPAEKIIRIGDKSADKKYESDNFWSMGDTGPCGP
CSEIFYDHGEDIFGGPPGSPDEDGDRFIEIWNIVFMQYNRHADGTMENLPKPSVDTGMGL
ERIAAITQGVHSNYEIDIFQRLIRDTAKLLECDDLEHKSLRVIADHIRSCSFLITDGVMP
SNEGRGYVLRRIIRRAIRHGHKLEAKSFFFHKIVASLAAQMGDAYPELVQQQATIEKILR
IEEEQFGRTLDRGMVLLEDILSELKGDTIAGDDVFKLYDTYGFPADLTADIARERQLHID
IEGFDAAMAQQRIRAQKASQFGTDYNETLKSEHRTDFKGYTRNEMSSTVVELFNAESSVK
ELKAGEAGIVVLDQTPFYAESGGQVGDSGTLLLDDGVFEVTDTVKLGHAFAHRGTARSTI
GLNSRVKAQINSERRAAIVKNHTATHILHASLRKVLGEHVTQKGSLCDAEKLRFDFSNFE
AVTPEELIMVERMVNEQIRSNLGRETNLMQIDEAKEKGAMALFGEKYDDEVRVVTLGDFS
TELCGGVHVDRTGDIGLFKIISESGIAAGVRRIEAVTGEAALNYFAEQEKTLNTIAAIVK
TDPVNVASKVEQVMLRNKELEKELAQFKQKLASAAGADLVSQAVDYNGVKALIANLEGVE
AKSLRGMVDDLKNKMGSGVILLATASDDKVSLIAGVTKDLIGKVKSGELVNVAAQEVGGK
GGGRPDMAQAGGSQPENIEAALKAAQSWLKDKLS
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgattgaaactagtgcccaattgcgtcaggcatttttagatttttatgcctctaagcag
caccaaattgtagcgagtagctcgcttgtccctggcaacgatgcgacattattatttact
aatgccggtatggtgccatttaaagatgtatttcttggcgacgatgttcgcagctacacc
cgagctacctcggcacaacgttgtgttcgcgcgggcggtaagcataatgatttagaaaat
gttggttatacagcccgtcaccatacttttttcgaaatgctaggtaattttagtttcggt
gattacttcaaagaagaagcgattaattacgcctgggaatttctaactaccgtattagca
ttgccaaaagaaaagttactggtaactgtttatgaaagcgatgatgaagcctataactat
tggctaaatgaaattggtgtgccagcagagaaaattattcgtattggtgataagtcagct
gataaaaagtatgaatcagataacttctggtcgatgggtgatactggtccatgtggtcct
tgttctgaaattttttatgaccacggtgaagacattttcggtggtcctccaggctcacca
gatgaagatggcgatcgctttatcgaaatttggaatatcgttttcatgcaatacaaccgt
cacgctgacggcacaatggagaatttacctaagccgtcagttgatacgggtatgggttta
gagcgtattgccgcaatcactcaaggtgtacatagcaattacgaaattgatattttccaa
cgcttaattcgtgataccgctaaattacttgaatgtgacgatttagaacacaaatcatta
cgtgtaattgccgatcatattcgttcatgtagcttcttgattactgatggtgtaatgcct
tcgaatgaaggacgtggctatgttttacgtcgtattattcgccgtgctattcgtcatgga
cataaattagaagctaaatcatttttctttcataaaatagtagcctcacttgccgcgcaa
atgggtgatgcataccctgaacttgttcaacaacaagctactattgagaaaattttacgc
atagaagaagagcaattcggtcgtacgttagatcgaggcatggtgctattagaagatatt
ttatctgaacttaaaggcgacactatcgcaggtgatgatgtatttaagttatatgatact
tacggctttccagcagatttaaccgctgacattgctcgtgaacgtcagttacacattgat
atcgaaggttttgatgccgcgatggctcaacagcgtattcgcgctcaaaaagccagtcag
tttggtacagattacaatgaaacacttaagtcagaacacagaactgactttaaaggctac
actcgcaatgagatgtcttctaccgttgttgagctatttaatgctgaatcatcagttaaa
gagctgaaagcaggcgaagcgggtattgtagtgcttgatcaaacgccattttacgctgaa
tcaggcgggcaagtaggtgatagcggtacgctactgcttgacgatggcgtatttgaagta
accgatacggttaaactcggtcatgcgtttgctcatagaggtactgctcgcagcactatc
ggtttaaacagtcgtgttaaagcgcaaattaatagtgagcgtcgcgctgctattgttaaa
aaccatacagctacgcatatattgcacgctagtcttcgcaaagtattaggcgaacatgtt
acacaaaaaggctcattgtgtgatgccgaaaaactacgttttgacttttctaactttgaa
gcagtaacacctgaagagttaatcatggttgaacgtatggtgaatgagcaaattcgcagt
aacttaggtcgcgaaaccaatttaatgcaaattgacgaagcgaaagaaaaaggcgctatg
gccttatttggtgaaaagtacgacgatgaagtgcgagtggttaccttaggtgatttctca
acagagctttgtggtggtgttcacgttgaccgaacgggtgatattggcttattcaaaatt
atatctgaatcaggtatagctgctggtgttcgtcgaatagaagcggtaacgggtgaagca
gcattaaattactttgccgaacaagaaaaaaccttaaataccattgcagcaatcgttaaa
actgaccctgttaatgtggcgagtaaggttgagcaagtaatgttgcgcaataaagagtta
gaaaaagaactggcacaatttaagcaaaaactcgccagtgcagccggagctgacttagta
agccaagctgtcgactataatggcgtaaaagcgcttattgctaatttagaaggtgtagaa
gctaagtctcttcgcggtatggtcgatgacttgaaaaataaaatgggctcaggtgttatt
ttattagcgactgctagcgacgataaagtgagtttaattgccggggtaaccaaagatctt
atcggcaaagttaaatctggcgagttagttaatgtagctgcacaagaagttggtggtaaa
ggtggtggtcgccctgacatggcacaagccggtggtagccagccagaaaacattgaagcc
gctttaaaagcagcgcaaagctggttaaaagataagttgagctaa

DBGET integrated database retrieval system