KEGG   Colwellia sp. PAMC 21821: A3Q33_08875Help
Entry
A3Q33_08875       CDS       T04816                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
colw  Colwellia sp. PAMC 21821
Brite
KEGG Orthology (KO) [BR:colw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3Q33_08875
Enzymes [BR:colw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A3Q33_08875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Glutaredoxin K_oxygenase AlaDh_PNT_C NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ARD44411
UniProt: A0A1V0KRU5
LinkDB All DBs
Position
2113263..2114873
Genome map
AA seq 536 aa AA seqDB search
MLDTNLKQQLTTYLQNLTSAVELSVFLGDDVKSKELNTLVAEIAEMSALVTIVEADASNE
RVPSMLVKSVKTGGEMRFAGVPMGHEFTSLVLALLHSGGHPIKLDKAVIEQVAALEGDYS
FETYISLSCQNCPDVVQALNMMAAINPQITHVMVDGALFQEEVYKRDILSVPAVYLNGKA
FGQGRMTVTEILNKVDTNAGARQAKAINNKEAFDLLVIGGGPAGAASAIYSARKGIRTGI
VADKFGGQLQDTIAIENFISVSATQGPKLVASLEAHVNDYDVDIMNNQRVKNIIKSDVEG
GLITVELENGATLQTRSTIIATGARWREMNVTGEQEYRGKGVAYCPHCDGPLFKGKSVAV
IGGGNSGIEAAIDLAGIVEHVTVLEFDSVLRADAVLQNKARSLPNIDIIVNAQTTEVLGN
GKHVTGLNYLNRATNKQENVELAGIFVQIGLLPNSQFLQGTVDLTDRGEVIINQKGETNI
AGVYAAGDVTNTPFKQIIIAMGGGAAAALGAFDYLIRTPNPLENRENIESMSEVAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacaaacttaaaacaacaattaactacctatttgcaaaatttaacatcggct
gttgaattgtcagtatttttaggtgacgacgtaaaatcaaaagaattaaataccttggtg
gcagaaatcgctgagatgtcagcgttagtaacgattgttgaagcagatgcaagcaacgaa
cgcgtaccatcaatgttagtaaaatcagttaaaaccggcggtgaaatgcgctttgcgggt
gtgcccatggggcatgagtttacctcactggtattagccttattgcatagcggtggacac
ccaataaaacttgataaagcggtaatcgagcaagtggcagcattagaaggtgactatagc
tttgaaacctacatttctttaagttgtcagaattgcccagacgtagtgcaagctttaaat
atgatggcagcaattaatccacaaattacacatgtgatggtggatggcgctttatttcaa
gaagaagtatacaagcgcgatattttatcagtacctgcggtttatcttaatggtaaagcg
tttggacaaggcagaatgacagtaaccgagattttaaataaagtagataccaatgcaggc
gcgagacaagctaaagccataaacaacaaagaagcctttgacttattagttattggtggt
ggtcctgctggcgcagcgtcagctatatatagtgctcgtaaaggtattcgcaccggaata
gttgctgacaaatttggcggtcagcttcaagacaccatagccattgaaaattttatctcc
gtcagtgcgacacaaggccctaaattagtcgctagtttagaagcgcatgtgaatgactac
gatgttgatattatgaataatcaacgggtgaaaaacattataaaaagtgatgttgaaggt
ggcttaattaccgttgagttagaaaatggtgccaccttacaaacacgctcaaccataatc
gcaacaggtgccagatggcgagaaatgaacgtcactggtgagcaagaatatcgtggtaaa
ggtgtggcttattgcccacattgtgatggacctttatttaaaggaaaatcagtggccgta
attggcggtggcaattcaggtattgaagcggcgattgatttagccggcattgttgaacat
gttactgtgttggagttcgactcagtattacgagcagatgcggtattgcaaaataaagct
cgctcgttaccgaatatcgatattattgtgaatgcacaaaccacagaggtgttaggtaat
ggtaagcatgtaactgggcttaattaccttaatcgtgcaaccaacaagcaagaaaacgtc
gaacttgccggtatatttgtacaaattggcttattgccaaattcacaatttttgcaagga
accgttgatttaactgatcgaggtgaggttattattaatcaaaaaggtgaaaccaatatt
gctggggtttatgccgccggagatgtaacaaatacgccttttaagcaaataattatcgcc
atgggtggcggtgcagcagcagctttaggggcatttgattatttaatcagaacaccaaat
ccacttgaaaatcgtgaaaatattgaaagtatgagcgaagttgccgcttaa

DBGET integrated database retrieval system