KEGG   Colwellia sp. PAMC 21821: A3Q33_11270Help
Entry
A3Q33_11270       CDS       T04816                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00250  Alanine, aspartate and glutamate metabolism
colw00410  beta-Alanine metabolism
colw00430  Taurine and hypotaurine metabolism
colw00650  Butanoate metabolism
colw01100  Metabolic pathways
colw01110  Biosynthesis of secondary metabolites
colw01120  Microbial metabolism in diverse environments
colw02024  Quorum sensing
Module
colw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:colw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3Q33_11270
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3Q33_11270
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3Q33_11270
   00430 Taurine and hypotaurine metabolism
    A3Q33_11270
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A3Q33_11270
Enzymes [BR:colw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A3Q33_11270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DnaI_N
Motif
Other DBs
NCBI-ProteinID: ARD44836
UniProt: A0A1V0KSV7
LinkDB All DBs
Position
2645714..2647342
Genome map
AA seq 542 aa AA seqDB search
MTVNKRTAKVSEESLHRIFTIPVAPNSTLGRIENEISQNLAGFLGAHIAATEQALSEIEK
DFADSQIPETPAFVSDHMHHLLDKLVSQSVHTSSPNFIGHMTSALPYFILPLSKLMIGLN
QNLVKIETSKAFTPMERQVLGMMHRLVYQDEEPFYQQWMHSANHSLGAFCSGGTVANLTA
LWVARNNLLKPDGEFKGVAREGLFKALKHYNYDGLAILVSARGHYSLKKSADVLGIGQDS
VIAIPTDENNKIDCQLLEEKCQELARENIQVLSIVGVAGTTETGNIDPLDKMADIAQRYN
AHFHVDAAWGGATLLSNKYRPLLKGIELADSVTIDAHKQMYVPMGAGLVVFKNPASVAAI
EHHAEYILRKGSKDLGSHTLEGSRPGMAMLVYAALHVISRPGYELLINSSIEKANYFAQL
IEQHADFELVTKPELCLLTYRYNPSSVQKLLANASDVEQENINVLLDKLTEFVQKRQREN
GKSFVSRTRIEVKKYQGRKTLVFRVVLANPLTTQTILQDVLAEQTLLAQESERFLPLLLS
MT
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaataaacgcacagcaaaagtttctgaagagtctttacatcgtatttttacc
attcctgttgcacccaattctacactgggtcgcatagagaatgagatatctcaaaacttg
gctggcttcctaggtgcacatattgcagcgacagaacaagccttaagcgaaattgaaaaa
gattttgctgactcgcagatccctgaaactcctgcttttgtttcagatcacatgcaccac
ttacttgataagcttgtgtcacagtctgttcatacctccagtccaaatttcattggtcat
atgacctccgcattaccgtactttattttacctttatcaaagctgatgattggcttaaat
caaaacttggtgaaaattgaaacgtcgaaagcatttaccccaatggaacggcaagtgctt
ggtatgatgcatcgtttagtttatcaagatgaagagccgttttatcaacaatggatgcat
agtgctaatcattcactaggcgcattttgctcaggcggcactgtcgctaatttaacggca
ctttgggttgcacgtaacaacttattaaagccggacggtgaatttaaaggagtagcgcga
gagggcttgtttaaggcacttaaacattataactatgacggtttagctatcttagtgtca
gctcgtggtcattattcactgaaaaaatcagcagatgttttaggtatagggcaagacagt
gttattgctattccaaccgatgaaaataataaaattgattgccaactgctagaagaaaaa
tgccaggagttggcgcgtgaaaatattcaagttctcagtattgtaggcgttgcaggcaca
acagaaaccggcaatatagacccgcttgataaaatggctgacatagctcaacgctataat
gcgcattttcatgttgacgccgcctggggtggcgcgactttattatcgaataaataccga
ccattattaaaaggtatcgagttagctgactcggtcactattgacgcacacaaacaaatg
tatgtgccgatgggggcagggctagtagtgtttaaaaacccggcctctgttgctgcgatt
gaacatcatgcggagtatattttacgcaaaggctcaaaagatttagggagccatacttta
gaaggttcacgtcctggtatggcgatgttagtctatgcagctttgcatgtgatcagtcgt
cccggctatgaattactgattaatagcagtattgaaaaagctaattactttgcgcaatta
atcgagcagcatgctgatttcgaattggttactaagcctgaattatgtttattaacttat
cgctataatccaagtagtgtacaaaaattgctggctaacgctagtgatgttgaacaagaa
aacattaatgtattgctggataaattgacagaattcgtccaaaaaagacaacgtgaaaat
ggtaaatcttttgtttctcgtacccgtattgaagtaaaaaaataccaagggcgcaaaact
ttagtctttcgtgttgttttagccaacccgttgaccacccaaactattctacaagatgta
ttagctgaacagacgttattggcacaagaaagtgaacgctttttacctttattgttgtcg
atgacctaa

DBGET integrated database retrieval system