KEGG   Colwellia sp. PAMC 21821: A3Q33_14925Help
Entry
A3Q33_14925       CDS       T04816                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
colw  Colwellia sp. PAMC 21821
Brite
Enzymes [BR:colw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A3Q33_14925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARD45468
UniProt: A0A1V0KUL2
LinkDB All DBs
Position
complement(3536744..3537325)
Genome map
AA seq 193 aa AA seqDB search
MAIELPALPYAMDALAPHISQETLEFHYGKHHNTYVVKLNGLIEGTDFEGKSLEDIVKTS
SAGVFNNAAQIWNHTFYWNSLSPNGGGEPSGALATAINASFGSFAEFKAKFTDSAINNFG
SSWTWLVKNADGSLAIVNTSNAATPLTDEGVTPLITVDLWEHAYYIDYRNLRPSYMEGFW
ALANWDFASANYA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaattaccagcactaccatatgcaatggatgcacttgcaccacatatttca
caagaaactttagagtttcactatggtaagcaccacaacacttatgttgttaagttaaac
ggtcttatcgaaggtactgattttgaaggaaagtctttagaagatatcgttaaaacatct
tctgctggtgttttcaataacgctgcacaaatttggaaccatacgttttactggaacagc
ttaagccctaacggcggcggcgagccatctggtgcattagcaacagctattaatgcaagc
tttggttcatttgcagaatttaaagcaaaattcactgacagcgctatcaataactttggt
tcaagctggacttggttagttaagaatgctgacggcagccttgctatcgttaatacatct
aatgcagcaactcctcttactgatgaaggtgtaacgccactaatcacagtagatttatgg
gaacatgcatactacattgattaccgtaaccttcgtcctagctacatggaaggtttctgg
gcattagcgaactgggattttgcctcagcaaactacgcttaa

DBGET integrated database retrieval system