KEGG   Colwellia sp. PAMC 21821: A3Q33_16345Help
Entry
A3Q33_16345       CDS       T04816                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00020  Citrate cycle (TCA cycle)
colw00190  Oxidative phosphorylation
colw00650  Butanoate metabolism
colw01100  Metabolic pathways
colw01110  Biosynthesis of secondary metabolites
colw01120  Microbial metabolism in diverse environments
colw01130  Biosynthesis of antibiotics
colw01200  Carbon metabolism
Module
colw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
colw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
colw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:colw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3Q33_16345 (sdhB)
   00650 Butanoate metabolism
    A3Q33_16345 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A3Q33_16345 (sdhB)
Enzymes [BR:colw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A3Q33_16345 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A3Q33_16345 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_16 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ARD45717
UniProt: A0A1V0KVD1
LinkDB All DBs
Position
3867162..3867872
Genome map
AA seq 236 aa AA seqDB search
MKQIFSIYRYNPDVDNKPYMKDYELEIPEGSDMMVLDALILLKEQDSSLSFRRSCREGVC
GSDGLNMNGKNGLACITPLSAVPANKIVLRPLPGLPVVRDLIIDMTQFYNQYEKIRPYLI
NDGKEQPAREHLQSIEEREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFL
IDSRDTATEERLDDLQDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLTRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattttttcaatttaccgttacaaccctgatgttgataacaaaccttacatg
aaagattatgagctggaaattccagaaggctcagacatgatggtactagacgcgttaatt
ttgctgaaagagcaagattctagcttatcgttccgtcgttcatgtcgtgaaggtgtttgt
ggctctgacggtttgaatatgaatggtaaaaacggtttggcatgtatcacgcctttatct
gctgttccagcaaataaaattgtgttacgtccattaccaggtttacctgtagtacgtgat
ttaattattgatatgacacagttttataatcaatatgaaaaaatcagaccttacctcatt
aatgatggtaaagaacaacctgcacgcgaacatttgcaatctatcgaagaacgtgaaaaa
ttagatggactttacgaatgtattttatgtgcttgttgttctacatcttgtccttctttc
tggtggaatcctgataagtttatcggtccagcgggtttattacatgcttatcgttttctt
atcgatagccgtgataccgctacagaagagcgtttagatgatttacaagatgcttacagc
gtatttcgttgtcacggcatcatgaactgtgttgatgtttgtccgaaaggattaaaccca
accaaagccattggccatattaagtcaatgttgctaaccagagcggtttaa

DBGET integrated database retrieval system