KEGG   Colwellia sp. MT41: CMT41_01055Help
Entry
CMT41_01055       CDS       T04159                                 

Definition
(GenBank) oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
com  Colwellia sp. MT41
Pathway
com00730  Thiamine metabolism
com01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:com00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CMT41_01055
Enzymes [BR:com01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     CMT41_01055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_9 ApbA NAD_binding_8 F420_oxidored Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ALO33459
UniProt: A0A0S2JC23
LinkDB All DBs
Position
243803..244987
Genome map
AA seq 394 aa AA seqDB search
MNIAIVGAGLMGRLLALSLLRNEQHRGEQLRQKQSQSVTITLFDKDNKLAHQSAAYAAAG
LLTPLGESLHCSPNIVSMGFESLGLWPTLLDSLHEHTFFQQTGAIMVSHEQDKGDYQRFV
RHLKNNYPEQVSHSLNRAELLELEPEIGRSFNQALYLPQEGQLGNRRLLVALRKQLAKES
PHASTGNRLNWLSECQVVGIDVGEHRSKVTYLQGSEKHSQSFDLVIDCRGTGATNNNSNS
ACAPLADLRSVRGELFQLFAPDVNISRPIRLMHPRYQLYIAPKGKGFYVVGATEIESDDD
SPMTVRSAMELLSAAYSVHPGFAEANIRQHVSQCRPAFSDNQPKITVQDTLIQVNGLFRH
GFLIAPVVLKQTLAVIENSINNTETALPYADLFS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgccattgttggcgcaggattgatgggacgattactcgccctgtccttactt
cgtaatgaacagcatagaggtgaacagcttcgacaaaaacagtctcaaagcgtaaccatt
actttatttgataaagataataaactcgcccaccagagtgccgcctatgctgccgcaggt
ttattaacaccattaggtgagtcacttcattgttcacctaatattgttagtatgggtttt
gagtcattaggtttatggccgactttgcttgatagtttgcatgaacataccttttttcaa
caaactggcgccatcatggtcagtcatgagcaagataaaggtgactatcagcgctttgtt
aggcacttaaaaaacaactatccggagcaagtatcacattcgctaaatcgagctgaatta
cttgaattagagcctgaaataggccgtagttttaaccaagctttgtacctgccacaagaa
gggcaactgggtaatcgccgtttattagtggcgctgcgtaagcagttggcaaaagaaagc
ccacacgccagtacaggcaataggcttaactggttaagtgaatgccaggtggtaggtatt
gatgtcggtgagcacaggagtaaagtgacctaccttcaaggaagtgaaaagcatagccag
agttttgatttagtgattgattgtcgaggtaccggggcaacgaacaataatagtaatagt
gcttgtgctccattagcggacttacgttcggttaggggcgagctgtttcaactgtttgca
cccgatgtcaatatttctcggccaatacggttaatgcatcctagatatcagctttatatc
gcgcccaagggcaaaggtttttatgtggtgggtgcaactgaaattgaaagcgatgatgat
tcacctatgacagtacgctcggcaatggaactattaagcgcagcttatagtgtgcaccct
ggttttgctgaagcgaatattcgtcaacacgttagccaatgcaggccagcctttagtgat
aatcagcctaaaatcaccgtgcaagatacacttattcaagtaaatggtttgtttcgccat
ggatttttgatagcccccgtggtgcttaaacaaacactggcggttattgaaaacagcata
aataataccgaaacagctttaccttatgctgacttattctcatga

DBGET integrated database retrieval system