KEGG   Colwellia sp. MT41: CMT41_03835Help
Entry
CMT41_03835       CDS       T04159                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
com  Colwellia sp. MT41
Pathway
com00250  Alanine, aspartate and glutamate metabolism
com00410  beta-Alanine metabolism
com00430  Taurine and hypotaurine metabolism
com00650  Butanoate metabolism
com01100  Metabolic pathways
com01110  Biosynthesis of secondary metabolites
com01120  Microbial metabolism in diverse environments
com02024  Quorum sensing
Module
com_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:com00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CMT41_03835
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CMT41_03835
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CMT41_03835
   00430 Taurine and hypotaurine metabolism
    CMT41_03835
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CMT41_03835
Enzymes [BR:com01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CMT41_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALO33954
UniProt: A0A0S2JD41
LinkDB All DBs
Position
909009..910640
Genome map
AA seq 543 aa AA seqDB search
MRATKRIAEATQESLHRIFTIAEAPDSTLGRLEQEMSQNLVGFLNNHIVASKNALSDIEK
DFVNPHIPEQPEFVSDHMHHLLDKLVAQSVHTSSPSFIGHMTSALPAFILPLSKLMVGLN
QNLVKVETSKAFTPLERQVIGMMHNLIYQQDDDFYKSWMHSAQHSLGTFCSGGTVANITA
LWVARNKLLQADGDFRGVAREGLHRAMRHYGYQDLAILVSERGHYSLKKSADILGIGQEN
VIAIATDENNKIDCQKLAEKCQQLSAKNIKVLAIVGVAGTTETGNVDPLDKMAVIAQKIQ
CHFHVDAAWGGATLLSNKYRPLLKGIEQADSVTIDAHKQMYVPMGAGIVIFKDPGSVSAI
EHHAEYILRKGSKDLGSHTLEGSRPGMAMLVYASLHIISRPGYEMLINQAIEKAEYFAEI
INQHDSFELITRPELCLLTYRYAPKSVQALLARNDNDANKSVNLLLGQLTKFIQKRQRED
GRSFVSRTRIEVGKYGGEKVIVFRVVLANPLTTKEILQDILEQQCQLALESENFLPELLQ
IAK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaactaagcgcattgccgaggcaacgcaagagtcattacatcgaatttttact
attgccgaagcgcctgattctactttggggcgccttgagcaagaaatgtcacaaaatttg
gttggttttttaaacaaccatattgttgccagtaaaaatgcgttatcggacattgagaaa
gattttgttaatcctcatattcctgagcagccagaatttgtctcagatcatatgcatcat
ttgctcgataaattagtcgcgcaatcagtacatacctctagtcctagttttattggtcat
atgacctcagcgctaccagcatttattttacccttatctaagctgatggtgggtttaaat
cagaacctagttaaagttgaaacctctaaggcttttaccccgctagaacgtcaagttatc
ggtatgatgcataacttgatctatcaacaggatgatgatttttataaaagttggatgcat
agcgcacagcattcactgggcactttttgctccggtggcacagtcgctaatattaccgct
ttatgggtcgcacgaaataagctactgcaagccgacggtgactttagaggcgtagctcga
gaaggcttacaccgtgctatgagacattatggctatcaagacttagctattttagtctcg
gaacgtggtcattactcactgaaaaaatccgctgatattctcggtataggccaagagaat
gttattgccattgccaccgatgaaaataataaaatagattgtcaaaagctggcagaaaaa
tgccagcaacttagcgctaaaaatatcaaagtactcgctattgttggtgttgccggtacc
acagaaaccggtaatgttgaccctcttgataaaatggctgtcattgctcagaaaatccaa
tgtcattttcatgttgatgccgcttgggggggagctacattgttatcgaataagtaccgt
cctttgcttaaaggcatcgaacaagccgactcagtaaccattgacgcgcataaacagatg
tatgtgcctatgggcgctggtatcgttatatttaaagaccctggctcggtgagtgccatt
gagcatcacgccgaatatatattacgtaaaggctcaaaagatttaggtagtcataccctt
gaaggctctcgcccgggcatggcgatgttagtgtatgccagtttgcatattattagccga
ccaggttatgaaatgctgattaatcaggctattgaaaaagcggagtattttgctgagatc
attaatcagcatgatagttttgagttaattacccgccctgaattgtgtctgttaacctac
cgttatgcacctaagtcagtacaagcactgttggctcgtaatgataatgacgccaataaa
tcggtgaatttgctacttggtcagttaaccaagtttattcaaaaacgccaacgcgaagac
ggtcgctcttttgtttcacgtactcgtattgaagtgggtaaatatggcggtgaaaaagta
atagtttttagagtcgtcttggccaacccattaaccacgaaagaaattttacaagatata
ttagagcagcaatgtcagttagcgctggaaagtgagaactttttacctgagctactgcaa
atagcaaaataa

DBGET integrated database retrieval system