KEGG   Colwellia sp. MT41: CMT41_04005
Entry
CMT41_04005       CDS       T04159                                 

Definition
(GenBank) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
com  Colwellia sp. MT41
Pathway
com00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:com00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CMT41_04005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:com01007]
    CMT41_04005
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:com03016]
    CMT41_04005
Enzymes [BR:com01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     CMT41_04005
Amino acid related enzymes [BR:com01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CMT41_04005
Transfer RNA biogenesis [BR:com03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CMT41_04005
 Prokaryotic type
    CMT41_04005
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Late_protein_L2
Other DBs
NCBI-ProteinID: ALO33980
UniProt: A0A0S2JD78
LinkDB
Position
950942..953572
AA seq 876 aa
MIKSTAEVRQAFLDFFATKQHQIVKSSSLVPGNDATLLFTNAGMVPFKDVFLGAEKRSYT
RATSAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKEEAISYAWEFLTVALG
IPKEKLLVTVYENDAEAFAYWKDEIGIPVEKIIRIGDKSADKKFESDNFWSMGDTGPCGP
CSEIFYDHGADIFGGPPGSPDEEGDRFIEIWNIVFMQYNRQSDGTMEPLPNPSIDTGMGL
ERIAAIMQNVHSNYEIDIFQALIKDTAALLGCSDLEHKSLRVISDHIRSCSFLIVDGVVP
SNEGRGYVLRRIIRRAIRHGHKLAAKGHFFHKIVASLVSQMGEAYPELVQQQATIEKLLR
IEEEQFGRTLDRGMILLEDILSNLSGDTIKGDDVFKLYDTYGFPIDLTADIARERQLKVD
HDGFDKAMAQQRKRAQKASQFGTDYNQQLKSDHKTAFKGYDNDSYSATVVELFNNQDQEP
VQQLNSGEQGIVILDHTPFYAESGGQVGDSGLLHLDGGVFEVTDTVKLGNAFAHRGTART
DIGLNRRVKAEINVERRAAIIKNHTATHLLHAALRKVLGEHVTQKGSLCESDKLRFDFSH
FEGVTAEELHAVEQMVNDEIRRNHSRKTESMYIEAAKEKGAMALFGEKYDDEVRVVTLGD
FSIELCGGVHVNRTGDIGLLKIVSESGIAAGIRRIEAVTAIGALAFINQQTASLTNIAAL
VKSDVANVTSKVELLVGRSKQLEKEIGQLKQELAAQAGSDLVNNVIEINGVKVLIADLGG
VESKALRGMVDELKNKMQSGVILLATANGAKVGLIAGVTKDLVGRVKAGELVNMVAQQVG
GKGGGRPDMAQAGGSQPENITQALASVSVWLTEKLA
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgattaaaagcaccgccgaagtccgtcaggcatttttagatttctttgccaccaaacaa
catcaaatagttaaaagcagctcattagtaccagggaatgatgccacgttattgtttacc
aatgccggtatggtgccttttaaagatgtttttctaggcgcagaaaagcgtagttatacc
cgagcaacgtcagcacaacgttgtgtacgcgcgggtggtaaacataatgatttagaaaat
gtcggctataccgcccgtcatcataccttttttgaaatgatgggtaactttagttttggt
gattattttaaagaggaagcgatcagctatgcttgggagtttttaaccgttgcgttgggc
ataccaaaggaaaaattactggtcactgtttatgaaaatgatgccgaggcttttgcttat
tggaaagatgaaataggtattccagtagaaaaaataattcgtataggtgataagtctgca
gataaaaagtttgagtctgataacttttggtctatgggcgataccggaccttgtggtcct
tgctctgaaatattttatgatcacggcgcagatatctttggtggacctccaggctctccc
gatgaagaaggcgatcgttttatcgaaatttggaacatagtatttatgcaatataaccgt
caaagtgacggtactatggagccattacctaacccatctatagacacaggtatggggttg
gagcgtattgctgccattatgcaaaatgtgcatagcaactacgaaatagatattttccaa
gcgttaattaaagatactgcagcgctacttggttgtagcgatcttgaacataaatcttta
cgggtaattagtgatcatatacgttcatgtagcttcttaattgttgatggcgtagtccca
tcaaatgaaggccgtggttatgtactgcgtcgtatcattcgccgcgcgattcgtcatggc
cataaattagcagcgaaagggcatttcttccataaaattgtagcttctttagttagccaa
atgggtgaagcttacccagagttagtgcagcaacaagcgactatagaaaaattattacgt
atagaagaagagcaatttggtcggaccttagaccgtggcatgattttactagaagatatt
cttagcaatttatcgggcgataccatcaagggtgatgatgtctttaaattatatgatacc
tatggttttcctatcgatttaacagcagatattgcccgtgaacgtcagttgaaggttgat
catgacggctttgataaagcaatggcgcaacaacgtaaacgggctcaaaaagcgagtcaa
tttggtactgattataatcagcagcttaaatctgatcacaaaactgcttttaaaggttat
gacaatgattcatattctgcgaccgtggtggaattattcaataaccaagaccaagagcca
gtacagcaattaaattcaggtgagcagggtattgtcattctagatcacacgcccttttat
gcagaatcaggtggccaggtaggtgatagtggcttattgcacctagatggcggagtattt
gaagtaactgataccgttaaattaggtaatgcctttgctcatagagggactgcgcggaca
gatattggtttaaatcgacgggtaaaagcggagattaatgttgaacgccgagccgctatt
attaaaaaccataccgcgacccatttattacatgccgcattacgaaaagtattaggtgaa
catgtcacgcaaaaaggttcattatgtgagagtgataaattacgctttgatttttctcat
tttgaaggtgttactgcagaagaattacatgcggttgagcaaatggttaatgatgaaatt
cgtcgtaaccactctaggaaaactgagtcaatgtacatcgaagcagctaaagaaaaaggt
gccatggcactctttggtgaaaaatatgatgatgaagtacgtgtggtaactctgggcgat
ttttcaatagagttatgtggcggtgtccatgttaatagaacgggtgatattggtttatta
aaaattgtttctgaatcgggtatcgcagcaggtattcgtcgtatcgaagcggttactgct
attggcgcgcttgcttttattaatcaacaaaccgcctctttaacaaatattgccgcgctg
gttaaaagtgatgtggctaatgttactagcaaagtagagctactggttggtcgctctaag
cagctggaaaaggaaatcgggcaattaaaacaggagcttgctgcacaagcaggctctgat
ttagttaataacgtgattgaaattaatggcgttaaagtgctaattgctgatttaggtgga
gtagagagtaaagcacttcgcggcatggttgatgaacttaaaaataaaatgcaatcaggt
gttatcctgcttgccaccgctaatggcgctaaagtgggcttaattgccggcgtaacaaaa
gatttagttggccgagttaaggcgggtgagttagttaatatggtggcgcagcaagtgggt
ggtaaaggtggcggacgtcccgatatggcgcaagcgggtggcagtcaacccgagaatatt
acccaggctctggcaagtgtgtcggtatggttgacagaaaaattagcttaa

DBGET integrated database retrieval system