KEGG   Colwellia sp. MT41: CMT41_06100Help
Entry
CMT41_06100       CDS       T04159                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
com  Colwellia sp. MT41
Brite
Enzymes [BR:com01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CMT41_06100
Peptidases [BR:com01002]
 Metallo Peptidases
  Family M2
   CMT41_06100
Exosome [BR:com04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMT41_06100
CD molecules [BR:com04090]
 Proteins
  CMT41_06100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ALO36584
UniProt: A0A0S2JKS9
LinkDB All DBs
Position
complement(1438519..1440369)
Genome map
AA seq 616 aa AA seqDB search
MKKIFKFTGLALIIAASLTACDQGSSQQASVEKVPSVSGQVTLTSADAQKFLDDVAKEMV
AMNLEGSRAAWIYANFITEDTAILAANADQKSTDAGVRYAMQAATFDQVDVNAVQRRQLN
FLKQRLVMPAPQDPSKSAELATIGAKLGSIYSKGSYTTKAGEKLSLGDMTAIMANSRDYD
ELLEMWSGWREISPEMKPLYIRQAELANEGAKGLGYPDLGAMWRSNYDMPADDFAKELDR
LWGQVKPLYDDLHCYVRTELGETYGTDKVPQDQPIPAHLLGNMWAQSWGNIYDLVAPEDA
DPGYDVTKQLAIHNYDEIDMVRGAEKFFTSLGFDALPETFYSRSLFTKPADRDVTCHASA
WDLDAKDDIRIKMCIQKTGEEFNVIHHELGHNFYQRAYKDQPVFFQNSANDGFHEAIGDT
IALSVTPKYLKEIGLIDTIPDESKDIGLLMKQALDKIAFIPFGLMVDQWRWKVYSGEITP
ENYNSSWWELREKYQGVAAPIDRDVNAFDPGAKYHVPGGVPYSRYFLAHIQQFEFHRALC
EISGNTDPIHRCSIYNSKEAGAALNTMLEMGSSQPWQQAYKVITGSEQMDASAILDYFAP
LHVWLKNKNQGKQCGF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
attaaaaaaatatttaagtttaccggtcttgctttaattattgccgcttctttaaccgcg
tgtgatcaaggttcaagtcaacaagcctcagtagaaaaagtgccctccgttagtggccaa
gtaacactaacctcggcagatgcgcaaaaattcttagatgatgtagccaaagaaatggta
gctatgaacctagaaggttcacgtgccgcgtggatatatgccaactttatcactgaagac
acagcgattttagccgctaatgccgatcaaaagtctaccgatgctggtgtgagatacgcc
atgcaagccgctacttttgatcaggtagacgttaatgctgtacaacgccgtcaactaaac
tttttaaaacaacgcttagttatgcctgcaccacaagacccgagtaaatcagctgagctt
gccaccataggcgctaagcttggcagcatttatagtaaaggtagctataccactaaagcg
ggtgaaaagcttagcttaggggatatgaccgctataatggccaattctcgcgattacgat
gaactacttgaaatgtggtcaggctggcgtgaaattagcccagaaatgaaacccctttat
atccgccaagcagagcttgctaatgaaggtgctaaaggcctgggttacccagatttaggt
gctatgtggcgttcaaattatgatatgcctgccgatgattttgcaaaagaattagaccga
ctttggggtcaagttaaacctctatatgatgacttacattgttatgtgagaactgagtta
ggtgaaacttacggtaccgataaagtcccgcaagaccaacctattccggctcatttatta
ggtaatatgtgggcgcaatcttggggaaatatttacgacttagtcgctcctgaagatgct
gatcctggttatgatgttactaaacaattagccattcataattatgatgaaatagacatg
gttcgtggtgcggaaaagttctttacctcccttggttttgacgccttaccagaaactttt
tatagccgttcattatttactaaacctgccgacagggatgtaacttgtcatgccagtgcc
tgggatctagatgctaaagatgatattcgcatcaagatgtgtatccaaaaaactggtgag
gaatttaatgttatccatcatgagttaggtcataacttctaccaacgtgcttataaagac
caaccagtattcttccaaaacagtgccaatgacggtttccatgaagctatcggcgatacc
attgccttatcagttacccctaaatacttaaaggaaatcggcttaattgataccattcct
gatgaatcaaaagacattggtttattaatgaagcaagcacttgataaaattgcatttatt
ccctttggtttaatggttgatcaatggcgttggaaagtttactccggtgaaatcaccccg
gaaaactacaacagctcatggtgggaattacgtgagaagtaccaaggtgtagccgcccct
atcgatcgcgatgtcaatgcattcgacccaggtgctaaataccacgtaccaggtggtgtg
ccttatagccgatatttcttagcacacattcaacaatttgaattccatcgtgcgttatgt
gaaatttcaggtaatactgacccgattcaccgctgttcaatttacaactctaaagaagcc
ggcgcagcacttaataccatgttagaaatgggttcaagccaaccgtggcaacaagcttac
aaagttattaccggcagtgagcaaatggatgctagtgcgattttagattacttcgcacca
ttacacgtttggttgaaaaacaaaaaccaaggtaaacagtgtggtttttaa

DBGET integrated database retrieval system