KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_03355Help
Entry
TQ29_03355        CDS       T04096                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    TQ29_03355
Enzymes [BR:con01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     TQ29_03355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: ALG89394
UniProt: A0A0N9NTY6
LinkDB All DBs
Position
complement(666898..667488)
Genome map
AA seq 196 aa AA seqDB search
MAKLYFNYSTMNAGKSTILLQASHNYRERGMETFLLTARLDTRAGNGRIASRIGIGENAE
TFDASDDLFAVIEARLSHGPCACIFIDEAQFLTKQQVWQLARAVDDLKIPVMCYGLRVDF
RGELFPGSAALLALADEMREVRTICHCGKKASMVVRRGPDGTALREGAQVQVGGNETYVS
LCRRHWRKEMGDTQTR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcaactattcgacgatgaacgcgggaaaatcgacgatcctgctg
caggcgtcgcacaactaccgcgagcgcggcatggaaaccttcctgctgaccgcccggctg
gacacccgcgccgggaacggccgcatcgcatcccgcatcggcatcggcgaaaacgccgaa
accttcgatgcctcagatgatctgttcgcggtgattgaggcgcggctgagccacgggcca
tgcgcctgtattttcatcgacgaagcacaatttttgaccaagcagcaggtgtggcagctt
gcccgcgcggtcgatgaccttaagattccggtgatgtgctatgggttgcgggtggatttc
cgcggggagcttttcccgggctcggccgcccttctggcgctggccgacgagatgcgcgag
gtacgcaccatctgccattgcggcaagaaagcatcgatggtggtgcgcagggggcctgac
ggcacggcgctgcgcgaaggggcgcaagtgcaggtcggcggaaacgaaacctatgtttcg
ctctgccgcaggcactggcgcaaggaaatgggcgacacccagaccagatag

DBGET integrated database retrieval system