KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_04990Help
Entry
TQ29_04990        CDS       T04096                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00564  Glycerophospholipid metabolism
con01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:con00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TQ29_04990
Enzymes [BR:con01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TQ29_04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored Lycopene_cycl FAD_binding_2 GIDA NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ALG89662
UniProt: A0A0N9NFN5
LinkDB All DBs
Position
complement(996302..997918)
Genome map
AA seq 538 aa AA seqDB search
MTGKTKRDSAAHFDLVVIGGGVNGCGIARDAAGRGLSVLLCEQGDLAQATSSASTKLFHG
GLRYLEYFEFRLVREALKERETLLRAMPHISWPLRFVLPYDPALRFPADASGLGRVLRYA
APFLRGRRPAWMIRAGLFAYDHLGGRCILPGTKTLRLADHPAGKPLKPRFARAFEYSDCW
VEDSRLVVLNARDAAAHGARILTRTRCDSAARTGAGWRVELTDLETGTAQNVTAAGIVNA
GGPWVEDILKTRLGQQAAHGVRLVRGSHIVTRRLFDHGQPYFFQLPDGRIIFAIPYETDF
TLIGTTDQDHRAAPGAAICTEDERDYLLAAANRVFTRALTPSDVVWSFSGVRPLYDDNAS
SATAATRDYVLTLQDENGAAPLLSVFGGKITTYRRLAEQALARLERHFPQMSGPWTAGAP
LPGGDFPVDGASALMARLRAVFPFLTEAWAARLVRAYGRDAYAVLGQATCPADLGEDFGA
TLHAAEVLWLIRNEWVKSADDILWRRSKLGLRLDTAAAARLEAFIGEARGARVQPAER
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaagacaaagcgcgacagcgcggcgcatttcgaccttgtcgtcatcggcggc
ggcgtcaacggctgcggcatcgcccgggatgcggccgggcgcgggctctcggtgctgctg
tgcgaacagggcgatctggcgcaggccacctcttccgcctcgaccaaactctttcacggc
gggctgcgctatctcgaatatttcgagttccgcctcgtccgcgaggcgctgaaagagcgt
gaaaccctgcttcgggcgatgccgcatatttcgtggccgctgcgctttgtgctgccttac
gatccggcgctgcgctttcctgccgatgcctccggccttggccgggttctgcgctatgcg
gcgccctttctgcgcgggcgcaggccggcatggatgatccgcgcagggctgtttgcctat
gatcatctgggcgggcgctgcatcctgcccggcaccaaaaccctgcggctggccgatcac
ccggcgggcaaaccgctgaagccgcgctttgccagggccttcgaatactccgattgctgg
gtcgaggattcgcggctcgtggtgctgaacgcccgcgatgccgcggcgcatggcgcccgc
atcctgacccgaacccgctgcgacagcgcggcgcgcaccggcgcgggctggcgggtggaa
ctgaccgacctcgagacaggaaccgcgcaaaacgtcaccgcagcgggcatcgtcaacgcg
ggcgggccatgggtcgaggatattctgaaaacccggctggggcagcaggcggctcatggc
gtccgcctcgtgcgcggcagccatatcgtgacgcgccggctgttcgatcacggccagccc
tatttctttcagctccccgacgggcggatcatcttcgccatcccttatgaaaccgatttc
acactgatcggcaccaccgatcaggatcaccgcgccgcccccggcgcggccatctgcacg
gaagacgagcgcgactatctgctcgccgccgccaaccgcgtcttcacgcgggccctgacc
ccctccgatgtggtctggtccttttccggcgtccgcccgctctatgacgataacgcctcc
agcgccaccgccgccacgcgcgattatgtgctgaccctgcaggatgaaaacggcgccgcg
ccgctgctcagcgtcttcggcggcaagatcaccacctatcgccggctggcggaacaggcg
ctggcccggctcgagcggcatttcccgcagatgtccggcccgtggacggcaggcgcgccc
ctgcccggcggcgatttcccggtcgatggcgcctccgcgctgatggcccggctgcgcgcc
gtcttcccgtttctgacagaggcctgggcggcacggctggtgcgcgcctatggccgtgat
gcctatgcggttctggggcaggccacctgccccgccgatctgggcgaggatttcggcgcg
acgctgcacgccgccgaagtgctctggctcatccgcaacgaatgggtcaaatccgccgac
gacatcctgtggcggcgcagcaagctcggcctgcgcctggataccgccgccgcggcccgg
ctggaggcgttcatcggcgaagcccgcggcgcccgcgttcagcccgccgaacggtag

DBGET integrated database retrieval system