KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_08205Help
Entry
TQ29_08205        CDS       T04096                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00010  Glycolysis / Gluconeogenesis
con00020  Citrate cycle (TCA cycle)
con00620  Pyruvate metabolism
con01100  Metabolic pathways
con01110  Biosynthesis of secondary metabolites
con01120  Microbial metabolism in diverse environments
con01130  Biosynthesis of antibiotics
con01200  Carbon metabolism
Module
con_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TQ29_08205
   00020 Citrate cycle (TCA cycle)
    TQ29_08205
   00620 Pyruvate metabolism
    TQ29_08205
Enzymes [BR:con01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TQ29_08205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALG90168
UniProt: A0A0N9N3Q5
LinkDB All DBs
Position
complement(1670194..1671483)
Genome map
AA seq 429 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDVVSSGDLLAEIETDKATMEFEAVDEGIVGKLL
IAEGSEGVKVNTPIAVLLEDGESADDIGNAPAPAPAARKEAAAAPVAPAAAPAPAAPVAG
GGARVFASPLARRIAADKGLDLAQLTGSGPHGRIIKADVEGATAAPEAAAPAAAAPVPAA
TTAMPAGPATETVLKMYQGREFEEIKLDGMRKTIAARLTEAKQTIPHFYLRRDIRLDALL
KFRGQLNRQLETRGVKLSVNDFIIKACALALQQVPDANAVWAGDRVLKLKPSDVAVAVAI
EGGLFTPVLQDADKKSLSALSAEMKDLAARARDRKLAPHEYLGGSFAVSNLGMFGIDNFD
AVINPPHGGILAVGAGVKKPVVGADGELAVATVMSVTLSVDHRVIDGALGAELLKAIVEN
LENPIAMLA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagaaatcctgatgcccgcgctctcccccacgatggaggaaggcacgcttgcg
aaatggctggtcaaggagggagacgtggtgtcttccggcgatctgctggccgagatcgaa
accgacaaggcgacgatggagttcgaggctgtcgatgaaggcatcgtcggcaagctgctc
atcgccgaaggcagcgagggggtgaaggtgaacacccccatcgccgttttgctggaggat
ggcgaaagcgccgatgacatcggcaacgcccctgcccctgcacccgcggccaggaaagaa
gcggcggcagcaccggtggcaccagccgcagcgcccgccccggcagccccggtggcaggt
ggcggcgcacgcgttttcgcgtccccccttgcgcggcgcatcgccgccgacaaggggctg
gatctggcccagctcaccgggtccggcccgcatgggcggatcatcaaggcagatgtcgaa
ggcgcgaccgcagcccccgaagccgccgcgccggcggcagcggcgcccgttcccgccgcc
accacggcgatgcccgcaggcccggccacggagaccgtcctgaaaatgtatcagggccgg
gagttcgaggagatcaagctcgacgggatgcgcaagaccatcgccgcgcgcctgaccgag
gccaagcagaccatcccgcatttctacctgcgccgcgacatccggctcgacgccctgctg
aaattccgcggccagttgaacaggcagctcgaaacgcgcggcgtgaaactttcggtcaac
gatttcatcatcaaggcctgcgcgctggcgttgcagcaggtgcccgacgccaacgccgtc
tgggccggcgaccgtgtgctgaagctgaaaccgtcggacgtggccgtcgccgtggcgatc
gagggtgggcttttcacacccgtcctgcaggacgccgacaagaaatcgctctcggccctc
tcggccgagatgaaagaccttgccgcccgcgcccgcgaccgcaagctcgcgccgcatgaa
tacctgggcggcagctttgccgtctcgaacctgggcatgttcggcatcgacaatttcgac
gccgtcatcaacccgccccatggcggcatcctggccgtcggcgcgggcgtgaaaaagccc
gtggtcggcgctgatggcgaactggccgtggcgacggtgatgtccgtgaccctctctgtc
gatcaccgggtcatcgacggcgcgctcggggccgagcttctcaaggcgatcgtggaaaac
ctggaaaacccgatcgccatgctggcctga

DBGET integrated database retrieval system