KEGG   Coprococcus sp. ART55/1: CCU_01490Help
Entry
CCU_01490         CDS       T02583                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
coo  Coprococcus sp. ART55/1
Pathway
coo00010  Glycolysis / Gluconeogenesis
coo00020  Citrate cycle (TCA cycle)
coo00620  Pyruvate metabolism
coo00640  Propanoate metabolism
coo00650  Butanoate metabolism
coo00680  Methane metabolism
coo01100  Metabolic pathways
coo01110  Biosynthesis of secondary metabolites
coo01120  Microbial metabolism in diverse environments
coo01130  Biosynthesis of antibiotics
coo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:coo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCU_01490
   00020 Citrate cycle (TCA cycle)
    CCU_01490
   00620 Pyruvate metabolism
    CCU_01490
   00640 Propanoate metabolism
    CCU_01490
   00650 Butanoate metabolism
    CCU_01490
  09102 Energy metabolism
   00680 Methane metabolism
    CCU_01490
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CCU_01490
Enzymes [BR:coo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CCU_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CBK82082
UniProt: D5HH27
LinkDB All DBs
Position
144578..145759
Genome map
AA seq 393 aa AA seqDB search
MAIRERLSGNEAVAHAIKQINPDVMPAFPITPSTEIPQFVSTFISNGEIDTEFIPVESEH
SAMSAAIGAEAAGCRTLTATSSCGMALMWEELYVAASNRLPLALALVNRALSGPININCD
HSDSMGARDTGWLQIYAENNQEAYDNFVQAYRISEHKDVRLPIMICQDGFITSHAVENIT
LIEDDLVKKFVGEYTPEQYLLNPEMPMAVGPYATSPYYMETKMAQNTAMKNAKQVILDVA
KEFEEMTGRHYGFFEEYRLDDADYAIVMIGSAAGTTKEAIDELRNEGKKVGLLKIRVFRP
FPGEEIAKALAHTKAVAILDRSEGFRAGGGPLSAEVKEHLYDIQATTKAVSYIYGLGGRD
YTVDSAKGVFAQLEDMIENGAEIPQYQYIGLRQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctataagagaacgtctttcaggaaatgaggctgtggcacatgctataaagcagatc
aatccggatgttatgcctgcatttcctataacaccttcaactgagatacctcagttcgtt
tcaacatttatctccaatggagagatcgatacagaatttataccggtagagagtgagcac
agtgccatgagtgcagcgatcggcgcagaggctgccggctgccgtacactcacagccaca
tcatcatgtggtatggctctcatgtgggaggagctctacgtggcagcgtccaatcgtctt
ccacttgccctcgcacttgtaaacagagcactctccggccctatcaacatcaactgtgac
cactcagacagtatgggcgcacgtgatacaggctggcttcagatatacgcagagaacaac
caggaggcatatgacaactttgttcaggcatacagaatatctgagcacaaggatgtcaga
cttcctatcatgatatgtcaggatggtttcatcacaagccatgccgttgaaaacatcacc
ctcatcgaggatgatctcgtaaagaagtttgtaggtgaatacacccctgagcagtatctg
ttaaatcctgagatgcctatggctgtcggtccttacgccacatctccttactatatggag
actaagatggctcagaacactgccatgaagaatgcaaagcaggttattcttgacgttgca
aaagaattcgaggagatgacaggccgtcactacggattttttgaggagtacagacttgac
gacgctgactacgccatcgttatgatcggttctgctgccggaacaacaaaggaagctata
gatgagctgagaaacgaaggcaagaaggtcgggcttctcaagatcagagtgttcagacca
ttccctggcgaggagattgcaaaggctctcgcccacaccaaggctgtggcaatccttgac
agatcggaaggattcagagcaggcggcgggcctctctcagcagaggtcaaggagcacctg
tatgacattcaggcaaccacaaaggctgtcagctacatctacggtctcggcggacgtgac
tacactgtggacagcgccaagggcgtatttgcacagcttgaagacatgatagagaacggt
gctgagattcctcagtatcagtacataggacttagacagtag

DBGET integrated database retrieval system