KEGG   Coprococcus sp. ART55/1: CCU_10050Help
Entry
CCU_10050         CDS       T02583                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein, PhoT family (TC 3.A.1.7.1)
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
coo  Coprococcus sp. ART55/1
Pathway
coo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:coo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CCU_10050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:coo02000]
    CCU_10050
Enzymes [BR:coo01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     CCU_10050
Transporters [BR:coo02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    CCU_10050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_33 RsgA_GTPase AAA_23 AAA_22 AAA_25 Rad17 AAA_16 AAA_18 AAA_28 RNA_helicase AAA NB-ARC AAA_30 AAA_24
Motif
Other DBs
NCBI-ProteinID: CBK82722
UniProt: D5HIW7
LinkDB All DBs
Position
1024007..1024765
Genome map
AA seq 252 aa AA seqDB search
MNNNVKFSVKNLNLYYGKFHALKGIDMDIPSNEVTAFIGPSGCGKSTFLKSLNRMNDLVE
GCKITGDVRLDGEDIYSGMDINLLRKRVGMVFQQPNPFPMSVYDNIAYGPRTHGIRNRAK
LDEIVERSLRQAAIWDELKDRLKKSALGLSGGQQQRLCIARALAVEPEVLLMDEPTSALD
PISTSKIEDLVLELKDNYTIIMVTHNMQQATRVADNTAFFLLGEVVEYAETEKMFSKPAD
KRTEDYITGRFG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacgttaagttcagcgttaaaaatttgaatctctattacggaaagttccat
gcccttaagggtattgatatggatattccgtcaaatgaggttacagcatttattggacca
tcaggttgtggaaagtcaacatttctcaagtcactcaacagaatgaatgatctggtagag
ggctgtaagataacaggtgatgtgaggcttgatggagaggacatatacagcggaatggat
attaaccttttgagaaaaagagttggaatggtattccagcagccgaatccttttccgatg
agcgtgtatgacaatatagcatatggcccaagaacccatggaataagaaaccgtgcaaag
cttgatgagatagttgagagatctctcagacaggcagccatatgggatgagcttaaggac
agactgaagaagtcagcacttggcctttcaggaggacagcagcagaggctctgtatagcc
agagcactggcagtggagcctgaggtacttctcatggatgagcctacatcggcccttgat
cctatatcgacatccaagatagaggacctggtacttgaactgaaggacaattacaccatt
atcatggttacgcataacatgcagcaggcaaccagagttgcggacaacacagcgttcttc
cttctcggagaggtcgttgagtacgcagagacagaaaagatgttcagcaagccggctgac
aagcgtacagaggattacatcaccggtagatttggttag

DBGET integrated database retrieval system