KEGG   Coprococcus sp. ART55/1: CCU_19530Help
Entry
CCU_19530         CDS       T02583                                 

Definition
(GenBank) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
coo  Coprococcus sp. ART55/1
Brite
KEGG Orthology (KO) [BR:coo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:coo03032]
    CCU_19530
   03400 DNA repair and recombination proteins [BR:coo03400]
    CCU_19530
Enzymes [BR:coo01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     CCU_19530
DNA replication proteins [BR:coo03032]
 Prokaryotic type
  DNA Topoisomerases
   CCU_19530
DNA repair and recombination proteins [BR:coo03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      CCU_19530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: CBK83419
UniProt: D5HET6
LinkDB All DBs
Position
2049303..2051861
Genome map
AA seq 852 aa AA seqDB search
MDDDKIFDKIDEVGLKKTMERSYIDYAMSVIAARALPDVRDGLKPVQRRILHSMIELNNG
PDKPHRKCARIVGDTMGKYHPHGDISIYEALVKLAQEWNTRYPLVDGHGNFGSVDGDHAA
AMRYTEARLSKISMEMMADINKDTVDFTPNFDGTEKEPVVLPSRYPNLLVNGTSGIAVGM
ATNIPPHNLKETINAAIKIIDNRVEEGRETEIDEIMDIVKGPDFPTGAQILGRQGINDAY
RTGRGKIKVRAITEIETMNNGKHRIVVTELPYMVNKSLLIKNMVDLVKNKRIDGITDIRD
ESSREGMRVVIELRKDVNANVILNQLFKHTQLQDTFGCIMLALVDGVPKILNIKDMLTYY
LKHQEDVVTRRTKYDLNKAEERAHILQGYLIALDNIDEVITIIRNSKNVGEAKAKLIERF
GLSEAQAGAIVDMRLRALTGLEREKIENEYNELIAKIAEYKEILADENKLLGVIKTELAA
IADKYGDERRTSITAYSDDITDEELIKREEIVISMTKLGYIKRMPKDTFKVQNRGGKGIK
GMNTIDNDIIDEIFLTNTHNFIMFFTNMGRVYRMKGYEIPESGRNARGVAIVNLLQLLPG
EKVTAIIPIAGFDKKYLMMATKNGIVKKTKIEAFENIRKTGLAAITLNEGDELIEVKATS
GENDVFLVTAKGMCIRFNEECVRDTGRTSMGVRGIRCDKGDEVIAMQLDVQGDEMLFVTT
KGMGKRTELSEFAPQMRGGKGVKCYRITEKTGDIVSAKAVTNDHDIMMMTNEGIMIRMHC
SDITVIGRITSGVKLMNIGKDGNTFVASVAKLARSDEDEEAEDSENPESAENEVSENVEN
DTENDAESNSEE
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgataagatttttgataaaatagatgaagttggtctgaaaaaaacaatggag
cgttcatatatagattatgccatgagcgttatcgctgccagagctcttcctgatgtaaga
gatggtcttaaacctgttcagcgaagaatacttcattctatgatagaacttaacaatgga
cctgataagccacaccgtaaatgtgcccgtatcgtcggtgatacaatgggtaaatatcat
ccacatggagacatttcaatatacgaggcacttgtaaagctggctcaggagtggaatacc
agatatccacttgtggatggacatggaaactttggatcggtcgacggtgaccatgccgct
gccatgcgatatacagaggcaagactttccaagatatccatggagatgatggcagatata
aacaaagatacagttgatttcacacctaactttgatggtacagagaaagaacctgtggta
ctaccatcacgttatcccaacctattggtaaatggtacatcaggtatcgcagtaggtatg
gctaccaatattccaccacataatttaaaggaaactatcaatgcagccataaagatcatc
gataacagagtggaagaaggacgtgagacagagatagatgagatcatggacatagtaaag
ggtccggattttcctacaggcgcacagatactgggcagacagggaataaacgatgcatat
agaacaggtcgaggcaagataaaagtacgtgcaatcacagaaatcgaaacaatgaacaac
ggaaagcaccgtattgttgtaaccgaactaccatatatggtaaataaatcacttcttata
aagaatatggtcgatcttgtcaagaacaagagaatcgatggaatcacagatataagagat
gagtcttcaagagagggaatgagagttgtcattgagcttagaaaggatgtcaatgccaac
gtaatactcaaccagctcttcaaacacacacagctccaggatacatttggatgtatcatg
ctggctctggtggatggagtacctaagatactcaacatcaaggacatgctcacatactac
ctgaagcatcaggaggatgttgtcacaagaagaacaaagtatgatctgaacaaggctgag
gagagagcccacatattacagggttatctcatagcactggacaacatagatgaggtcatc
acgatcatcagaaattcaaagaatgttggagaggctaaggcaaagctgatcgaaagattt
ggactttccgaggcacaggccggagcaatcgttgatatgagactccgtgctctgacaggt
ctggaaagagagaagatcgagaacgagtacaatgagcttattgcgaagatagctgagtac
aaggagatacttgcagatgagaataagcttcttggagttatcaagactgagcttgcagcg
atagctgacaagtacggtgatgagagaagaacatccataactgcatattcagatgatata
acagatgaagagcttatcaagagagaagagatagttatctccatgacaaagctcggatat
atcaagagaatgccaaaggataccttcaaggtacagaacagaggcggcaagggtatcaag
ggaatgaacaccatcgacaacgatataatcgatgagatattccttactaatacccacaac
ttcataatgttcttcaccaatatgggaagagtatacagaatgaagggatacgagatacct
gagtcgggacgtaatgcaaggggtgttgcgatagtcaaccttcttcagcttcttcctggt
gagaaggtaacagccataatccctatagccggatttgacaagaagtatctcatgatggct
acaaagaatggtattgtaaagaagaccaagatagaggcatttgagaatataagaaagacc
ggtctggcagccataacactgaatgagggagatgaactcatagaggttaaggcaacgagc
ggtgagaatgatgtatttcttgtaactgccaagggtatgtgtatcagattcaatgaggaa
tgtgtccgtgatacaggacgtacatccatgggtgtacgtggaataagatgcgacaagggc
gatgaagttatagcaatgcagcttgatgttcagggcgacgagatgctcttcgtaaccaca
aagggtatgggtaagagaactgaactgtcagaatttgcccctcagatgagaggcggtaag
ggtgtcaaatgttacaggataaccgagaagaccggtgacatcgtcagcgcaaaggccgtg
acaaatgaccatgacattatgatgatgaccaatgagggaatcatgatcagaatgcattgt
tcagatataactgtaataggaagaataacctcaggtgtcaagcttatgaatatcggcaag
gatggcaacacatttgtggcatctgttgcaaagcttgcaagaagtgatgaagatgaagag
gcagaggactcagagaatccagaatcagcagaaaatgaagtatcagagaatgtagagaac
gatacggagaatgatgccgagagtaattcagaggagtaa

DBGET integrated database retrieval system