KEGG   Coprococcus sp. ART55/1: CCU_24600Help
Entry
CCU_24600         CDS       T02583                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
coo  Coprococcus sp. ART55/1
Brite
KEGG Orthology (KO) [BR:coo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:coo01001]
    CCU_24600
Enzymes [BR:coo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CCU_24600
Protein kinases [BR:coo01001]
 Serine/threonine kinases: Other
  Bacterial family
   CCU_24600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like DUF4436 Seadorna_VP7 Kdo ETRAMP
Motif
Other DBs
NCBI-ProteinID: CBK83819
UniProt: D5HFY6
LinkDB All DBs
Position
2603366..2605576
Genome map
AA seq 736 aa AA seqDB search
MLNPGTMLSGRYEIIELVGSGGMSEVYKAKCHVLNRYVAIKVLKPEFSSDVNFVTKFRIE
AQSAAGLSHPNIVNVYDVGEDNGIYYIVMELVEGTTLKEYIQAHGRIEPMQAIDFAIQIA
QGLQAAHEHHTIHRDIKPQNIIMSNNGTLKVTDFGIARAASSSTTTTNAMGSVHYISPEQ
ARGGFSDERSDIYSLGITMYEMLTGHVPFEGENNVAIALMHIQGEMVSPREYYPDIPTSL
EKIIRKCTQKKPERRYLTANALIADLNRVKENPNIDCIVVPKTSVPTSPTIEMTKQEMEM
IKTGRQVDKADTTEIPPVSPRTSEIKANVPVMPPSQFDDLFPDDDDEEDDTDESVADDGE
QEQEYDGEEELDPRLKKIIMVSSIAIAVVLAILAILLIGKIAGWNILGGKGKTEESTDVI
TTEGTNDTTAQETVPMVNVVGLYKTAAEEQMKKNGFTNYTFVEKTDATVEKGYVISQSID
DGTSITKDTQITIYVSSGKEKTKVPDVLGYEDSQATTLLEEAGLKVTHGYAYDDNVEKDH
VIFSDPVAGTEVEEGSTVKIIISNGKETKKIAVPKLKGMSEADAAAKLQEVNLVGNPSYE
YSDDVKEGQVISQDPEVNTEVDEGTTVSYVVSKGPQKVTYSVSFSGSISNIEFDFDTFGS
VTVDISYTIGRQTFSVYSGKAGAGDFPINIDGVEGPTGLESNQGSFSVTITDSEGIDVTS
SFNTGGLSATFTQESN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatccgggaacgatgctcagcggtcgttatgagatcatagaattggttggatct
ggcggtatgtcagaggtatataaggcaaaatgtcatgtgttaaacagatatgttgccata
aaggtgcttaagcctgagttcagctcagacgttaattttgttacaaagttcaggatagag
gcccagtctgcggcggggctgtcacatcctaatattgtgaatgtatacgatgtcggtgag
gacaacggaatatattatatagtaatggagcttgtggagggaaccaccctcaaggaatat
atacaggcccacggcagaatagagcctatgcaggcgatcgattttgccatacagatagcc
cagggacttcaggcagcccatgagcatcacacgatacacagagatataaagcctcagaac
atcatcatgtcgaacaacggcacgctgaaggttactgatttcggaatcgcaagagccgca
tcgtcaagcacgaccacgacaaatgcgatgggtagtgttcactacatatcaccggagcag
gcaaggggcggattctcagatgagagaagtgatatttattcactcggtatcaccatgtat
gagatgctcacaggacatgttccatttgaaggcgagaacaatgtggctatagcgctgatg
cacattcagggcgagatggtatcacctagggagtattacccggatatacctacaagcctt
gagaagatcataagaaagtgtacacagaagaagccggagagacgatatctcacagcaaat
gcgcttatagctgatctcaacagagtaaaagagaatcctaatatagattgtatagtagtg
cctaagaccagcgttcctacatcccctaccattgagatgacaaagcaggagatggagatg
atcaagaccggaagacaggtcgataaggcagatactacggagattccacctgtaagtccg
agaacgtcagagatcaaggctaacgtgccagttatgccgccgtcacagttcgacgatctg
ttcccagatgacgacgatgaagaggatgatacggacgagtcagtggcagatgatggagaa
caggagcaggaatacgatggagaagaggagcttgatccaagacttaagaagataatcatg
gtatcaagtattgctatcgcggtggttcttgccatacttgccatacttctcataggcaag
atagccggctggaatattctgggcggtaagggtaagacggaggaaagcaccgatgtcata
accacagagggaacgaacgacacaactgcacaggagacagtacctatggtcaatgtagta
ggtctgtataagactgcggctgaggagcagatgaagaagaatggcttcaccaactataca
tttgtggagaagacagatgccacagttgagaagggctatgtaatatcacagagtatagat
gatggaacatccataacaaaggatacacagataactatttacgtgtcatcgggcaaggaa
aagaccaaggtgccggatgttctcggatatgaggacagtcaggccacaacattgctcgag
gaggcaggacttaaggtaacacatggctatgcgtacgatgataatgttgagaaggatcat
gtaatattctcagatcctgttgccggaacagaggttgaggagggctcaacagtcaagata
atcatcagtaacggtaaggagacgaagaagatcgcagttcctaagctcaagggtatgtct
gaggcagatgcagcagctaagcttcaggaggtcaacctggtaggcaatccaagctatgag
tacagcgatgatgtgaaggaaggccaggtaatatcacaggatcctgaggtcaacactgag
gttgacgagggaactaccgtgtcatatgttgtcagtaagggaccgcagaaggttacatac
tctgtatctttcagcggttcaatatcgaatatagagtttgattttgatacatttggaagt
gtgacagttgacatctcatacacaataggcagacagacattctctgtatacagcggcaag
gctggtgcaggagacttccctatcaatatagatggagttgagggtcctacaggacttgag
agcaaccaggggtcattctctgtgaccatcacggattcagagggaatagatgtcacatca
agctttaacacgggcggtttgtccgctacatttacacaggagagtaattag

DBGET integrated database retrieval system