KEGG   Corynebacterium pseudotuberculosis 31: Cp31_0038Help
Entry
Cp31_0038         CDS       T02029                                 

Gene name
pknA
Definition
(GenBank) Serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cop  Corynebacterium pseudotuberculosis 31
Brite
KEGG Orthology (KO) [BR:cop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cop01001]
    Cp31_0038 (pknA)
Enzymes [BR:cop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cp31_0038 (pknA)
Protein kinases [BR:cop01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cp31_0038 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal WaaY RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AFH89877
LinkDB All DBs
Position
complement(39746..41266)
Genome map
AA seq 506 aa AA seqDB search
MSIDYASPDPALQALIGDDYRLQWVVGTGGMSTVWLADDTRNQREVAVKVLRPEFSDNNE
FLSRFRNEALASENIISENVVQTFDYRELTDPSGRTLCFIVMEYVRGESLADMLARKGTL
DEDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGKVKITDFGIAKAAAAVPLTR
TGMVVGTAQYVSPEQAQGKDVTEASDVYSLGVVGYEMLAGRRPFTGDSSVSVAIAHINQA
PPALPTTVSAPARELIGIALRKDPAHRYADGNELALAVSTTRMGQRPPQPQSAQLQQIAP
EPTPTASTHALGQTAQPTTVIPATGEVPQTVSVGQMTGTHTGYSAAPATIPPEEKKKSSG
GVGTGLAVGVLLAALFGAGVWAASQGIFGDLLGGSDQPSSSVNPETITATVTETPTIREE
PRPIQRPQVTPTISSEPSEFPDASESVVPLPPTDNPRTAPTVDLNERSQVPSTHQNTSPT
PTRGNGSDPIADLLNTLNTPEQGGAP
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgattacgcttctccagatcccgcgcttcaggccctcatcggcgacgactat
cgtctccagtgggttgtgggtaccggcggcatgtctacagtatggcttgccgacgacacc
cgtaaccaacgcgaggtagcagtcaaggtcctgcgtcctgagttttctgataacaatgag
ttcctctccaggttccgcaatgaggcgctcgccagcgagaacatcatctcagaaaacgtt
gtacaaacttttgattatcgcgaactcaccgacccatctggccggacattgtgcttcatc
gtcatggaatacgtgcgtggtgagtctctcgcagacatgttggcgcgtaaaggaaccctc
gatgaggatcttgccctcgatgtcctcgagcaggcggcccatggcttatccattattcac
aggatgggcatggttcaccgcgatattaagcccggaaacctcctgattacccaaaacggc
aaagtaaaaatcaccgattttggtatagctaaggcggcggccgctgtcccgttgactcgc
accggcatggtagtgggaactgcacaatacgtctcaccggagcaagctcagggtaaagat
gtcaccgaagcatcagacgtctattcccttggcgttgtggggtatgagatgctcgccggc
agacgtcctttcacaggtgattcctctgtctcggtagctatcgcccatatcaaccaggca
ccacccgctcttcccactacggtttccgccccagcccgtgagcttatcggtatcgccttg
cgtaaggacccagcgcatcgatatgccgacggcaatgagcttgccctggcagtgtctact
actcgtatggggcagcgtcccccgcagcctcagtcagcacagctccagcagatagcacct
gaaccaacccctactgcatcaacccacgcattaggtcagacggcacaacccaccacggtt
atcccagccactggagaggttcctcagactgtttctgttggtcagatgacggggactcat
actggttatagcgcagctcccgcaacaattccgccggaggaaaagaaaaagagctctggc
ggagtaggcactggtcttgctgtgggagttctcctcgcagcattatttggtgccggcgta
tgggctgccagccaaggtatctttggcgatttgttgggaggaagtgaccagcccagtagt
tcggtcaatcccgagacgattaccgcaacggtcacggaaacgcctacgattcgggaagaa
ccacggccaatccagcgtccacaggtaactcctacgattagcagtgagccttcggaattt
cctgatgcctcagaatctgttgttccgctgccgcccacggacaatccccgaacagcgccg
accgtagatctcaacgagaggtcgcaagttccttccactcatcagaatacgtctcccact
ccaacacgcggaaacggttctgaccccatcgccgatctattgaacactcttaatacccca
gaacaaggaggtgccccatga

DBGET integrated database retrieval system