KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1113Help
Entry
Cp31_1113         CDS       T02029                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
cop00620  Pyruvate metabolism
cop00680  Methane metabolism
cop01100  Metabolic pathways
cop01120  Microbial metabolism in diverse environments
cop01200  Carbon metabolism
Module
cop_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cp31_1113 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Cp31_1113 (ppc)
Enzymes [BR:cop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cp31_1113 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFH90926
LinkDB All DBs
Position
complement(1263850..1266669)
Genome map
AA seq 939 aa AA seqDB search
MSVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGIAAFDRVEAARQLAFKISRKESQVE
DLVALLKDISAADAIPIIRAFSHFALLANMVEDLHDELGRLRRQEAGEQDPDSTLGATWK
KLANAGITNEKVSSLLSNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKKRHAILSSETN
ALTTARLEENTRHIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYELSLLTAIPEINKQV
ADHIQREYGVNSEDALQSLLIKPGSWIGGDHDGNPYVTAGTLHYATTRAAETVLKFYVRE
LHQLEHELSLSDRLTDVSPDLRKLADLGHNDVPSRVDEPYRRAVHGVRGRVLATLASRIG
PETVEGSWYSRHAAYTAPEQLAADLDIIDASLRRTHDELIADDRLLRIRTAVSSFGFHLY
SMDLRQNSESYEDVLTELFERAQVTPHYRKLDESEKISVLIAELSSPRPLIPRDGLPYSE
LTQRELDIIFEAKQAVDAFGTMMIPHSIISMAESASDILEPMVLLKEFGLIKIQEGHLTG
HIDVIPLFETIDDLQNGAKILQDLWQIPLYRSYLEQRGNLQEVMLGYSDSNKDGGYLAAN
WALYAAETDLVNICKQHGIALRLFHGRGGTVGRGGGPSYEAILAQPHGAVQGSVRVTEQG
EITSAKYGSVGAARRNLEALASATLEASLLKIDQVEEQYPEAYEIMGEISRLSQKKYSRL
AHEDPGFIEYFTSSTPLEEIGELNIGSRPSSRKQTKSIDDLRAIPWVLSWSQSRVMLPGW
YGVGSALHEWIEKGCVQTAELSADERLVVLQELNSSWPFFSSVLSNMAQVMSKAEMQLAK
LYSGLVADQEAANRIFSDISAEFELTKKMFLKITGFSGLLDDNPMLARSVRSRYPYLLPL
NTLQLEMLRRYRKGDDDPKVVHGIRLAMNGLATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaagctacgtctgcgggtccactatccgaacaacttgttgaggacatacgc
tttctcggtgctcttttaggggaggtgatcaaggaacaagaaggaatagcagcctttgac
cgggtggaggcagcaagacagctggcttttaagatttctcgtaaggaatcacaggttgaa
gacttagtggcattgctaaaggatatttcagcagcagatgcgataccaatcattagagca
tttagtcatttcgcgctactcgcaaacatggtggaggacttgcacgatgagttgggcaga
cttcggcgacaggaagccggtgaacaagatccagattcaactttaggcgccacatggaaa
aagctggcgaatgctggcataacaaatgaaaaagtttccagtttgctgagtaattttcaa
gtggctccagtgcttactgctcaccctacggaaacccgtagacgcacgatcttcgatgct
caagagcatatgactactctgcttaaaaagcgtcatgcgattcttagctctgagacaaat
gcgctgacaactgcacggcttgaagaaaatactcgtcatattcgtaggtggctgacctta
atatggcaaactgcgcttatccgtgtagcccgtcctcggattgaagatgaggtagaagtt
gggttgcgttattatgagctctctttactcactgcgatccctgagatcaataagcaagtg
gctgatcacatccagagagaatatggtgtgaactccgaagatgctttgcagtcactattg
attaagcccggaagctggatcggtggcgatcatgacggcaacccgtatgtcactgcagga
actctgcactacgcgacaacgcgagccgccgagactgttttaaagttttatgtacgtgaa
ctgcatcaacttgaacacgagttgtcgctatcagacagactcaccgatgttagcccggat
ctgcgtaagcttgcagatctaggccataatgatgttccttcacgggtagacgaaccgtat
cgtcgtgccgtccatggtgtacgtggtcgagtacttgccacactagcttctcgaatcggc
ccagaaacagtagaaggctcatggtattcccgtcatgctgcgtatactgcacctgagcaa
ctcgcagctgatttggacattatcgatgcttctttgcggagaactcacgatgagctcatc
gcagatgatcgtctgctgcgcatacggacagcagtatcgagctttggtttccatctttac
tcgatggatctgcgtcaaaactctgagagttacgaggacgtgcttactgagctctttgag
cgggcccaagtaactccgcactatcgaaaattagatgagagcgaaaaaattagcgttttg
atcgctgagctatcctcgccaaggcctctcattccgcgcgatggcttgccgtacagcgag
ttaacgcagcgggaactcgatattatttttgaggcaaagcaagccgtggatgcctttgga
acaatgatgattccacactctattatttcgatggcagaatctgcgagcgacattctcgag
ccaatggtcctactgaaagaatttggattaatcaagattcaagaaggccatctcacaggg
catattgacgttatacctctttttgaaacaatcgatgacctacaaaatggtgcaaagatt
ctccaagatttgtggcagataccgctgtatcgcagttatttagagcaacgaggcaatctc
caggaagtgatgctcggttattccgattccaataaagatggtggctaccttgccgcaaac
tgggctttatatgcggcagaaactgaccttgtaaacatatgtaagcaacatggtattgct
ctgaggcttttccacgggcgtggtggcaccgtagggcgtggtggcggtccctcttatgag
gcaattctcgctcagccacatggtgcggtgcaaggtagcgtacgcgtcacggagcaaggc
gagattacctcggcaaagtacggttctgtgggagctgctcgccgtaatctggaggctctg
gcctcggccacattggaagcttctttgctcaagatcgatcaagtagaagaacagtatcct
gaggcctatgaaattatgggcgaaatttcgcggttgagtcagaaaaagtattcgcggctt
gctcatgaagatcccggattcattgaatatttcacgtcatcgacgcctttggaagaaata
ggggagctcaatatcggctctcgtccttcctcgagaaaacagactaagagcatcgatgac
ttacgcgcgattccctgggtgcttagttggtcgcagtcacgtgtcatgcttcccggttgg
tatggagtaggcagtgctctacatgaatggatagagaaggggtgcgtgcagacagcggaa
ctatctgcggatgaacgtctcgtggttctgcaagagcttaattcttcctggccattcttt
tcttcggtgttgtctaatatggcgcaggtgatgagtaaggctgagatgcagctcgccaag
ctctactcagggctagtagcagaccaagaagccgcaaataggatattctccgatatctct
gctgaatttgagcttactaagaaaatgttccttaagattaccggtttttcggggcttctc
gacgacaaccctatgcttgcacgatcagttcggtcccgctatccatacttgctacctctt
aatacgctgcaacttgaaatgttacgtcggtatcgcaagggggatgatgaccctaaggta
gtgcatggtattcgtctggctatgaatggcttggccaccgcgctgcgaaattctggttag

DBGET integrated database retrieval system