KEGG   Commensalibacter sp. AMU001: D9V35_00270Help
Entry
D9V35_00270       CDS       T05684                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
coq  Commensalibacter sp. AMU001
Brite
KEGG Orthology (KO) [BR:coq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D9V35_00270
Enzymes [BR:coq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     D9V35_00270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AYN87639
LinkDB All DBs
Position
57531..58643
Genome map
AA seq 370 aa AA seqDB search
MEKNGKPSITKIDNIPKTMKAIVAYAPHDYRLEEVPVPQIGSEEILVKVEACGICAGDTK
AFDGAPSFWGDEKQPAYIKAPMIPGHEFIGHVVAYGDKIKDFKLNDRIISEQIVPCWECR
FCKRGEYWMCEKHDLYGFQNNVNGGMAEYIKLPKEAINYHLPDDLPMKQAVLVEPYACSL
HAVQRASVKLGDFVVLSGAGTLGLGMIGALKKSGPDKLVVLDLNDDRLALAKKFGADIVM
NPAREDVVKKIKDMTEGYGCDIYIEATGAGKSVEQGLSMIRKLGRFVEFSVFKDPVSVDW
SIISDRKELDVLGSHLGPYCYPMVIKGIQNGDFPTEGVVTHVFPLKDFKEAFDIMKKGVG
SLKVVLDPNL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaacggtaaaccttctattacaaaaatagataatattcccaagacaatgaaa
gcaattgttgcttatgcgccacatgattaccgtttggaagaggttcctgtaccacaaatt
gggtctgaagaaattcttgttaaagtagaggcgtgtggaatttgcgctggggataccaaa
gcatttgatggggcaccaagtttttggggggatgaaaagcaacctgcctatattaaggct
cccatgatacccggtcatgaatttattgggcatgttgttgcctatggcgataaaatcaaa
gatttcaaactgaatgaccgtattatttccgaacaaattgttccttgttgggaatgccgt
ttctgtaaacgtggtgaatactggatgtgtgaaaaacacgatctttacggttttcaaaac
aacgttaatggcggcatggcagaatatataaaattgcctaaagaagcgattaactatcat
ttgccagatgatcttcccatgaaacaggctgttctggttgaaccatatgcctgttcatta
catgccgtgcaacgtgcaagtgttaagttgggagattttgtggtgctatctggtgctggc
actctgggtttaggtatgattggcgcattgaaaaaatccggccccgacaaactggttgtt
cttgatttgaatgatgatcgtttagcactggctaagaaattcggtgctgatatcgtgatg
aatccagcccgtgaagatgtcgtcaagaaaatcaaggatatgaccgaaggatatggttgc
gatatttatattgaagctacgggtgcaggcaaatcagtagagcagggtctgtcaatgatt
cgcaaacttggtcgttttgttgaattttctgtattcaaagatccagtatcggttgactgg
agtatcattagtgatcgtaaggagttggatgtcttgggatcacatttgggtccttattgc
tatcccatggtgatcaagggaatacaaaatggtgattttccaacggaaggcgttgtaacg
catgttttcccgctaaaagattttaaagaagcttttgacataatgaaaaaaggagtgggt
tctttaaaggtcgtactcgatccaaatttataa

DBGET integrated database retrieval system