KEGG   Commensalibacter sp. AMU001: D9V35_02035Help
Entry
D9V35_02035       CDS       T05684                                 

Gene name
gatA
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
coq  Commensalibacter sp. AMU001
Pathway
coq00970  Aminoacyl-tRNA biosynthesis
coq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D9V35_02035 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:coq03029]
    D9V35_02035 (gatA)
Enzymes [BR:coq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     D9V35_02035 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     D9V35_02035 (gatA)
Mitochondrial biogenesis [BR:coq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    D9V35_02035 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase COX6C
Motif
Other DBs
NCBI-ProteinID: AYN86365
LinkDB All DBs
Position
431602..433083
Genome map
AA seq 493 aa AA seqDB search
MLTEMTITDAVEGLRQKKFSAEELTRDHLKAVGQLNSRINAYITVTEEVALGQARAADEK
LASGDAPVLTGIPLAIKDLFCTRDIPTTAASRILENFVPPYESTVTSNLLRNGAVFLGKT
NLDEFAMGSGNLNSAFGAVENPWKRKNDDAFLVPGGSSGGSAAAVAARMALGATGTDTGG
SIRQPAAYCGITGIKPTYGRCSRWGIIAFASSLDQAGPMAKTVEDCAILLQSMAGFDPKD
STSVDKAVPDYRAACNRSLKGLRVGIPEEYRAPGMSSEIEAIWQQGIDWLKEAGCEIVDV
SLPHTKYGLATYYIIAPAEASSNLARYDGVRYGRRVSGKSLEELYANTRGEGFGTEVKRR
ILMGTYVLSAGYYDAYYLRAQKVRKLIYQDFMNAYEKVDVLLTPTAPSAAFAKGEHQDDP
VQMYLNDIFTVPASMAGVPGLALPAGLNDQGLPLGLQLLGRPFDEETLIAVGSAMEKAAN
FTYKPAIRSGVSL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagaaatgacgattacagacgcggtcgagggcctgcgtcaaaagaaattcagc
gcggaggaattgacacgggatcatctgaaggcggttggtcagttaaacagtcggatcaat
gcctatatcacggtaacggaagaggtcgcccttggtcaggccagggcggcagatgaaaaa
ctggcttcgggggatgcgccggtactgaccggtattcctttggcgatcaaggatcttttt
tgtacaagggacattccaacaaccgccgccagccgtatcttggaaaattttgttccaccc
tatgaaagtacggtgacctcgaatttattgaggaatggagccgtttttttgggcaagacc
aatcttgatgaattcgcgatgggatctggcaacctgaattcggcattcggtgccgttgaa
aatccatggaaacgcaaaaatgatgatgcgtttctggttcccggcggctcttctggtggt
tccgcggctgccgtggcggcgcggatggctctgggggcaactggaacggatacgggtggc
tccattcgtcagccggcagcatattgcggtatcactggaatcaagccaacctatgggcgg
tgcagtcgttggggcattattgcctttgccagctcgcttgatcaggctggacccatggca
aaaaccgttgaggattgtgcaatcttgttgcaatcaatggccggttttgatccaaaagac
agcacaagcgtggacaaagcggttccggattatcgtgcggcctgtaaccgttcattgaag
gggttgcgtgtgggtattccagaagaatatcgcgctcctggcatgtcatctgaaatagag
gcaatctggcagcagggaattgactggttgaaagaggccggttgcgagatcgtggatgtt
tccctgcctcatactaaatacggattggccacctattatatcattgcccctgctgaagcc
tcatccaatctggcccgttatgacggggtgcgctatggtcgtcgtgtcagtggaaaaagt
cttgaggaactctatgcgaatacacgcggagagggttttggtacagaggtgaaacgccgt
attttgatgggtacttatgtgttgtcggccggttattacgatgcctattatctccgggcg
cagaaggttcgcaaacttatctatcaggatttcatgaatgcctatgaaaaggtggatgtt
ctcttgacaccaacggcaccatcagccgcttttgccaaaggtgaacatcaggatgatccc
gtacaaatgtatctgaatgatattttcaccgttcccgccagtatggccggagtgcctggt
ctggccttgccggccgggttaaatgaccagggtcttcccctgggtttgcagttgctgggt
cgtccatttgatgaggagaccctgattgctgttgggtcagcaatggaaaaagctgccaat
ttcacatataaacccgccattcgttctggagtttccctatga

DBGET integrated database retrieval system