KEGG   Commensalibacter sp. AMU001: D9V35_06555Help
Entry
D9V35_06555       CDS       T05684                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
coq  Commensalibacter sp. AMU001
Pathway
coq00480  Glutathione metabolism
coq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D9V35_06555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:coq02000]
    D9V35_06555
Enzymes [BR:coq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D9V35_06555
Transporters [BR:coq02000]
 Other Transporters
  Pores ion channels [TC:1]
   D9V35_06555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 HTH_ABP1_N Glutaredoxin Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AYN87174
LinkDB All DBs
Position
complement(1450173..1450841)
Genome map
AA seq 222 aa AA seqDB search
MRILYHLPLCPFSRKIRLIMAEKRLSFELMTEAVWKKRDEFLSMNPAGTVPVLVEETGLA
ICDSYAISEYLEEAYPDTLLMGRTLAERVEVRRLVAWFDDKFNREITRNLLFEKMFKRLF
GNSNPNAQALREGYQNIKFHLDYIAYLAENRVWLAGNNLSIADFAAAAHLSSLDYIGDIN
WDKYPMVKDWYVRIKSRPSFRALLNDRVSGVVPPKYYADLDF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatattgtatcatcttcccctttgtcctttcagtcgtaaaattcgattgataatg
gcagaaaaacgattatcttttgaattgatgaccgaagctgtatggaaaaaacgggatgaa
ttcctgtcgatgaatcctgctggtaccgttcctgtcctggtagaagaaacgggtctggct
atttgtgattcctatgcgatcagcgaatatttggaagaagcctatcctgacacgttatta
atgggtcgcactttagcggaaagagtggaggtgcgacgattggttgcctggtttgatgac
aaattcaatcgagaaatcactcgaaatttactgtttgagaaaatgttcaaacgtcttttt
ggaaatagcaatcccaatgctcaagcattgagagaaggctaccagaatataaaatttcat
cttgattatattgcttatctagctgaaaacagggtttggctggcaggaaataatttgtca
attgctgattttgctgctgcagcccatctttctagcttggattatattggtgatattaac
tgggataaatatccaatggtaaaggattggtatgttcggataaaatcccgccccagtttt
cgtgccttgttaaatgatcgggtaagtggtgtagtccctcccaaatattatgccgattta
gatttttaa

DBGET integrated database retrieval system