KEGG   Commensalibacter sp. AMU001: D9V35_07625Help
Entry
D9V35_07625       CDS       T05684                                 

Definition
(GenBank) 2-hydroxyacid dehydrogenase
Organism
coq  Commensalibacter sp. AMU001
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 IlvN
Motif
Other DBs
NCBI-ProteinID: AYN87369
LinkDB All DBs
Position
1682998..1683933
Genome map
AA seq 311 aa AA seqDB search
MKPQILQLVPVCKKFQEQINTRFTNHISLNKLPDSPEILKKIEAVITNGVVGAPSDMLDQ
LPNLKLVTVHGVGYDNVDLQKLKERQIKLSIATNAPTQDVADMAIALLLDVSRQITLRDQ
YIRKNEWEKGNYPYQGSSISNKKIGIMGMGHIGQAIAQRLHAFDNEIAYTARHQRPGVKW
KYIPSLIELAKISDILIIAASGGPSSRHAVNREILEALGERGFVVNIGRGSIIDENALID
CLKNKKIAGAGLDVFEHEPHVPETLRLLKNVIMTPHSAGATYETSKRIGAKILNSLECFF
KGENLPDEVHF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcaaattctccaattagtacctgtctgcaaaaaattccaggaacaaatcaat
actcgcttcaccaatcatattagccttaataaattgcctgattctcctgaaattctcaaa
aaaatcgaggctgtaattacaaatggtgttgttggtgctccatcagatatgctggatcaa
cttcccaatctaaaactcgtgacagtccatggggtgggatatgacaatgttgacttgcag
aaattaaaagaacgtcaaatcaaactaagtattgctacaaatgcaccaactcaggacgtg
gcagacatggcaatcgcattattattggatgtatcccgtcaaataaccctgcgtgaccaa
tatatacgcaaaaatgaatgggaaaaaggaaactatccttatcaaggaagttccatttca
aataagaaaataggaatcatgggaatgggtcatattggtcaggccattgcccaacgttta
catgcatttgataatgaaattgcctacacagcaagacatcaacgtcctggagtaaaatgg
aaatatattccctccttgatcgaattggccaagatatcagatatcctaataattgccgcc
agcggcggtccctcatccagacacgctgttaatcgcgaaatccttgaggcacttggtgaa
agagggttcgtcgttaatatcgggcgcggcagtatcattgatgaaaatgcattgatagac
tgcctgaaaaacaaaaaaatagctggagccggactggatgtttttgaacatgaacctcat
gttccagaaaccttacgtttgttaaaaaatgttatcatgacccctcattcagcaggcgcg
acttatgaaacctcaaagcgtatcggtgcaaaaatcctaaattccctggaatgttttttt
aaaggtgaaaacctccctgatgaagtgcatttttag

DBGET integrated database retrieval system