KEGG   Commensalibacter sp. AMU001: D9V35_07730Help
Entry
D9V35_07730       CDS       T05684                                 

Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
coq  Commensalibacter sp. AMU001
Pathway
coq00860  Porphyrin and chlorophyll metabolism
coq01100  Metabolic pathways
Module
coq_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:coq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D9V35_07730
Enzymes [BR:coq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     D9V35_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: AYN87389
LinkDB All DBs
Position
1708588..1709604
Genome map
AA seq 338 aa AA seqDB search
MKHFKSITELRKLCLVLPEKDKKAEQATFTRQNNLLKPPGSLGELENLVAWLASWQKKEM
PSLDKVCIMIFAGNHGITDESVTPYNAVVTELMVTQIEQGHAAINQLAKTAGAELRIIPL
NHFEKTKNFCHEAAMSEHDFLKAVETGYNAVTPNINLLCLGEVGIGNTTIAAALSAALFG
GNGAQWVSKGTSQSPEYIQNKQRVVDKALAKHQDILDDPLEICRHFGGYEEAALLGATLA
ARYLNIPVLLDGFVCTSAVAALQKLNPSGLDHAKISHLSAEKGHLLLAGNLNQYPLIAFN
MRLGEGSGCAITIPILQGALACYKGMSTYDEAGLPSPK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactttaagtctattaccgaattaagaaaattgtgccttgtactgcccgaaaag
gataaaaaagctgaacaggccacttttacccgccagaataaccttttaaaacctcctggc
agtttaggagagcttgaaaatctggttgcatggctagcatcctggcaaaaaaaagaaatg
cccagcctcgataaggtatgtatcatgatttttgctggaaaccatggcattaccgacgaa
agtgtcacaccctataatgctgtcgttacggaattgatggtcacccagatcgaacaggga
catgcagcaattaaccagctggcaaaaactgcgggagcagaactgcgtattatccctcta
aatcattttgagaaaaccaaaaacttctgtcatgaagcggccatgtcagaacatgatttc
cttaaggcggtcgagacgggatataatgccgtaacacccaatatcaatctgctttgttta
ggggaagttggaattggcaatacaacaatagctgccgctttgagtgccgccctgtttggt
ggaaatggcgcccaatgggtcagcaaaggcacaagtcaatcgcctgaatatatccagaac
aaacaacgtgttgttgataaggctctagccaaacatcaggatattctcgatgacccactt
gaaatttgccgacactttggtggatatgaagaagcggctttgttgggggccactttggct
gctcgttatctcaatattccggtattattagatggttttgtttgcaccagcgctgttgct
gcattgcaaaagctaaacccgtcaggtcttgatcatgcaaaaatcagccatctttctgca
gaaaaagggcatttgttattggccggaaacctgaaccaatatcctttgatagcctttaat
atgcgattgggagaaggcagcggatgcgcaataaccattccaattcttcaaggtgcccta
gcctgttataaaggtatgtccacctatgatgaggccggattaccttctcctaaatga

DBGET integrated database retrieval system