KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1695Help
Entry
Cp4202_1695       CDS       T02053                                 

Gene name
cydC
Definition
(GenBank) ATP-binding/permease protein cydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Cp4202_1695 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cos02000]
    Cp4202_1695 (cydC)
Transporters [BR:cos02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Cp4202_1695 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_29 AAA_30 AAA_16 AAA_18 AAA_22 AAA_25 DUF898 T2SSE RsgA_GTPase NTPase_1 AAA_24 NACHT AAA_23 DUF1376 Rad17 AAA AAA_14
Motif
Other DBs
NCBI-ProteinID: AEP70936
LinkDB All DBs
Position
1873141..1874670
Genome map
AA seq 509 aa AA seqDB search
MRNRDLVGAILAASITLISALGLSVLSGWLITRAWQMPPILDLAIAITAVRALGISRAVF
RYIDRLISHRLALRALRNLRSTVFQSIAETTTPHSDAILTQGDQLTRLSKDTERVTDFIV
RSLVPSGTALVVSIIAVTFTFLLLPSAGLVLLVSFCVTGLFIPWLSQRSSNKLLQRTAVE
SEDAWEQKLQEVLSHRVEFHAAGIAQQRADSAIDASRRASDDQIRATRNDSVQAFLLSLS
CDLTVLAIAWLGLQNYSGSPMWLGMLVILSLAAFESHAELAKASIHADVVSTASQALAEV
TGKALPSPPEASLFTDTTLKVSHLQCLHTDKTWDFTLAPNERRLITGPSGVGKTTLLYTL
AGLLEPRSGSASIGGDSSAAARRSLIRMHPENEWLFSTNIRENIRVANPDAPDALIEATL
RALGMGQWLDTNQGLDTVLVDGASSLSSGQRRRLLLARALCSTAPILLLDEPTAHISHTD
ASRFLDILLHKPLPGALPQRSLIIVSHSQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaccgagatctggttggcgctatcctcgcagcaagcatcactcttataagcgcg
ctcggtttatctgttttatccggctggcttatcactcgggcatggcagatgcctccaatt
ttggacttggcaatagccatcaccgcagttagagccctgggtatttcccgggcagtgttc
agatatattgaccgcttgatctcccatcggctggctctccgcgcactacgcaatctccgc
agcactgtttttcagagtatcgccgagaccacgaccccccattccgatgcgatcctcaca
caaggcgatcaactcacccgtctttccaaagacactgaacgggtgactgattttattgtc
cgatcgctcgttccatctggtaccgcactggtggtatccattatcgcggtaacttttact
tttcttttgctgcccagcgctggcttggtactcctcgttagtttttgtgtcaccggcttg
ttcattccttggctttctcaacgctcatccaacaaactgctgcagcgcactgccgttgaa
tcagaagacgcgtgggaacaaaaattgcaagaggtgctttctcatcgcgtagagtttcac
gccgcaggcatcgcgcaacaacgagccgactcggcgatcgatgcttctcgacgcgcctcc
gatgatcaaatccgtgcgactcgaaacgactctgtacaggccttcttgctgtcactctcc
tgcgacctcacggtcctggcaatagcctggctgggacttcagaactatagcggctcaccg
atgtggctagggatgctagttatcttgtctttggcggcctttgaatctcatgccgagcta
gcaaaagcctctatccacgcggacgttgtttccactgcgtcacaagccctagcggaggtc
accggtaaggcgctaccgagtccccccgaggcctcgcttttcacggatacaacgttaaaa
gtttcccatctgcagtgcctgcatacagacaaaacatgggatttcacgctcgcacccaac
gagcggcgccttatcactggtcccagcggagtcggaaaaaccacgctgctctacacccta
gctgggttattggagcctcggtccggaagcgcctcaattggaggagactccagtgcggcg
gctcgaagatcactcatccgcatgcatcctgaaaacgaatggcttttttctaccaatatc
cgggaaaacatccgtgttgctaaccctgatgcccccgatgccctcatcgaggccacgctt
agggcgttggggatgggccagtggctagatacaaatcagggcctggacacggtgcttgtc
gacggcgccagctcactttctagcggccagcggcgccgattactgctggctcgggcgttg
tgctctactgcgccaatcttgcttctcgacgaacccaccgcccacatctcccatacagat
gcctctcgtttcctcgatatcttgctgcataaaccactgcccggcgcgctgccccagcgt
agcctcataattgtcagccacagccagtag

DBGET integrated database retrieval system