KEGG   Candida orthopsilosis: CORT_0A04430Help
Entry
CORT_0A04430      CDS       T02488                                 

Definition
(RefSeq) Pho8 protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cot  Candida orthopsilosis
Pathway
cot00730  Thiamine metabolism
cot00790  Folate biosynthesis
cot01100  Metabolic pathways
Module
cot_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CORT_0A04430
   00790 Folate biosynthesis
    CORT_0A04430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cot04147]
    CORT_0A04430
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cot00537]
    CORT_0A04430
Enzymes [BR:cot01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CORT_0A04430
Exosome [BR:cot04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CORT_0A04430
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cot00537]
 Enzymes
  CORT_0A04430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 14536751
NCBI-ProteinID: XP_003866271
UniProt: H8WWK7
LinkDB All DBs
Position
1:948727..950394
Genome map
AA seq 555 aa AA seqDB search
MTNRGERSALLGGDSLIYNNKPKSNFKKNISYILNVVTIITIAILLFRHPSKSENKPKVP
SVDPHGKKNIIMMVTDGMGPASLSAARSFRQLRDKLPIDDVLVIDKYLIGSSRTRSSSSL
ITDSAAGATAFSCGLKSYNGAIGVDSEKTPCGTILEALKLQGYMTGLVVTTRITDATPAA
FSSHVDYRFQEDLIAQHQLGEYPFGRAVDLILGGGRCHFVPTANGGCRADKRDLIKEAVN
NGWSYAGDRKQFDQLNGGKNVSLPLLGLLANHDIPYDIDRSSKEFPSLAEQVKVALTALQ
EATRDSDQGFFLLVEGSRIDHAGHHNDPAAQVREVLAYDDAFKEVIDFIDSTDVETVAIS
TSDHETGGLVTARQVTESYPDYLWYPQVLLNSSHSGEHLARKIYSQKVKSGTKFTEYIKQ
EILEKDMGITDYTEDEVKQISLKSSQPEALLYFLNNMISFRAQIGWTTHGHSAVDVNIYA
HTNSFPLLNKLKSRKAYDGLTGNHENIEIGAFMETVTGSNLNQITEMIKKTIHSPHHGKS
DLSRDEFHANAIPSL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccgaggcgagagactggctttacttggaggagactccttgatttacaacaac
aagcctaagtcaaactttaaaaagaacatttcctatattttgaacgtggtcacgataatc
actattgcaatattattattccgtcacccatcaaagtcagagaacaagccaaaagtacca
tcagttgatcctcatggtaaaaagaatatcattatgatggttaccgacggaatgggacca
gcaagtttatcagcagcaagatctttccgccaacttagagataaattacctattgatgat
gtattagttattgacaagtacctcattggatcgtcaaggactagatcgtcgagctctttg
ataactgattctgcagcaggtgctactgccttttcatgtggactcaaatcatacaatgga
gccattggtgttgactcagagaaaacaccatgtggtacgattttagaagcgttgaagtta
caaggttatatgacgggtttggtggtaactactaggataaccgatgccacgcctgccgca
ttcagctcacatgttgactaccgtttccaagaagatttaattgctcaacaccaactaggt
gaatatccattcggtcgtgctgttgatttgattttaggtggtggaagatgtcatttcgtc
cctactgccaatggtggatgtagggctgacaaaagagatttaattaaagaagcagtaaac
aatggatggtcatatgctggtgatagaaaacaatttgatcaattgaatggtggtaagaat
gtgagcttaccattattaggattattggcaaaccatgacatcccttacgacattgatcgt
agcagcaaagaatttccatctttagcagaacaagtcaaggtcgcattaactgcattgcaa
gaggcaactagggactcagatcaagggttctttttgttggttgaaggatcaagaattgac
catgcaggccatcataatgatccagcagcacaagttagagaagtgttggcatatgacgat
gcatttaaagaagtgattgatttcattgactctactgatgtggaaactgttgctatatcc
actagtgatcacgaaactggtggcttggtaactgctagacaggtgacagaatcgtaccca
gattatttatggtacccacaagtattgttaaacagtagtcattcaggagagcatttggca
agaaagatctacagtcaaaaagtcaagtctggtaccaagttcactgaatacatcaaacaa
gaaattttggaaaaagatatgggtattactgattacactgaggatgaagttaaacagatt
tccttaaaatcgtctcaaccggaagcattattatattttttaaataatatgatttcattt
agagctcaaattggttggacaacccatggtcattcagcggttgatgtcaatatttatgca
catacaaactcatttccacttttaaataaattaaaatcaagaaaagcatatgatggatta
actggtaaccatgaaaatattgaaattggtgcatttatggaaactgtaactggatcaaat
ttgaatcaaattaccgaaatgattaaaaagacaattcattctcctcatcatggcaagagt
gatttgtcacgtgatgaatttcatgctaatgccattccttcgttatag

DBGET integrated database retrieval system