KEGG   Candida orthopsilosis: CORT_0A05610Help
Entry
CORT_0A05610      CDS       T02488                                 

Definition
(RefSeq) Gsy1 UDP glucose/starch glucosyltransferase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cot  Candida orthopsilosis
Pathway
cot00500  Starch and sucrose metabolism
cot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CORT_0A05610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cot01003]
    CORT_0A05610
Enzymes [BR:cot01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CORT_0A05610
Glycosyltransferases [BR:cot01003]
 Polysaccharide
  Storage polysaccharide
   CORT_0A05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 14536801
NCBI-ProteinID: XP_003866388
UniProt: H8WY01
LinkDB All DBs
Position
1:1238139..1240250
Genome map
AA seq 703 aa AA seqDB search
MTRDITNHLLFEVATEVAHKVGGIYSVLKSKAPITVAEYRERYTLIGPLNYHSAQIEVEE
LPVKDPLIKQTLDSMSAKGVRWLYGRWLIEGAPRVLLFDIWSAGHFLNEWKADLWNIAGI
PTPDHDSETNEAILLGYLVAWFLGELVYNDRDRAVIAHFHEWLAGIALPLCRKRRIDVTT
IFTTHATLLGRYLCAGSTDFYNNLANFDVDAEAGKRGIYHRYCIERSATHSADVFTTVSH
ITAFESEHLLKRKPDGVLPNGLNVVKFQAVHEFQNLHAMKKEKINEFIKGHFYGNYDFDL
ENTLYFFIAGRYEFRNKGCDFFIESLARLNHRLKESGSKMTVVAFIIMPGRTQSYTVETL
KGQAVVKQLESTIEEVQKKVGERLFEHCARYPNSEHAAGKSNEVPSIDELIKPADRVLLK
RRIYALKREGLPPIVTHNMIDDNTDPILNQIRRVQLFNRPEDRVKIIFHPEFLNANNPIL
SLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMEDLIENTSDYG
IYIVDRRMKSVDESIDQLTGYMFDFCEKTRRQRINQRNRTERLSDLLDWKRMGLEYIKAR
QLSLKRAYPDKFKNGANPFNNSTNLKLTRPLSVPGSPRSKVGLMTPGDLGSLQEAHEGLN
TDDYVGFKLGLGANDDDNEDGDGDQHYPLTLRGNSVPPEDKAE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgactagagatattactaaccatttactttttgaggtggctaccgaagttgctcacaag
gtgggaggaatttactcagtgttaaaatcgaaagcacctattacggttgctgaatacaga
gaacgttatacattgattggacctttgaactaccattcagctcaaattgaagtagaagag
ttaccagtcaaggatcccttgattaagcaaactttggattcgatgtctgccaaaggtgtt
cgctggctttatggaagatggttaattgaaggggcaccaagagtgttgcttttcgacatt
tggtcggctggtcattttcttaacgagtggaaagctgatttatggaatatagccggaatt
ccgaccccagaccatgatctggaaactaatgaggccattttattaggatacttggttgca
tggttcttgggtgagttggtttacaatgatcgtgacagggctgttattgctcatttccat
gaatggttggccggtatcgcattgcccttgtgtcgtaaaagaagaattgatgtcacaact
atctttacaacgcatgcaacattgttgggaagatacctttgtgccggatcgactgatttc
tacaacaacttggccaattttgacgttgatgccgaagctggtaaacgaggaatttatcat
cgttattgcattgaaaggtcagccactcattcagctgatgtattcaccactgtttctcat
atcacagcgtttgaaagtgagcatttgttaaaaagaaagcctgacggtgttttaccaaat
ggtttaaatgttgtcaaattccaagctgttcatgaatttcaaaacttacatgccatgaag
aaagaaaaaatcaatgaatttatcaagggacacttttatgggaattacgactttgacttg
gaaaatacactatacttttttattgctggtagatatgaattcagaaacaagggatgcgat
ttctttattgaaagtttggcaaggttaaatcacagattgaaagagagtggctccaaaatg
acagtcgttgcttttattataatgccaggaagaactcaatcatacacagttgaaactttg
aaaggacaggcagttgttaaacaattggagtctaccattgaggaggttcagaagaaagtt
ggtgaacgtttgtttgaacattgtgcaaggtatcctaattcagaacatgcggctggcaag
tcaaatgaagtaccatcaatcgatgaattaatcaagcctgctgatcgtgtgttattgaag
agaagaatttatgcattaaagagagaaggtttgccgccaatcgtcactcataatatgatt
gatgataatacagatcctattttaaaccaaattagacgtgttcaattattcaatcgtcca
gaggacagagttaagatcattttccatccggagttccttaatgccaacaacccaattttg
tccttggattatgatgagtttgtacgtgggtgtcatttgggtgttttcccatcttattac
gagccatggggctatactccggcggaatgtaccgtcatgggaattccttccatcacaaca
aatctttctggattcggatgttatatggaagacttgattgaaaataccagtgattatgga
atttacattgttgatcgaagaatgaaatcagttgatgagtctattgaccagttaactggt
tatatgtttgatttctgtgaaaaaactaggagacagagaatcaaccaaagaaacagaacc
gagagattgagcgatttattggattggaaacgaatgggattggagtatatcaaagcccgt
caattaagtttaaagagagcatatcccgacaagttcaaaaacggtgccaatccattcaat
aactcaactaatttaaaattgacaagaccgctttcagttccaggctcacctagatccaag
gttggattaatgactcctggtgatttaggaagtttacaagaagcgcacgagggtttgaat
acggatgattatgtggggttcaaattaggtttgggtgccaatgatgacgataatgaggat
ggagatggagatcaacattatccattgactttaagagggaattcggtaccccccgaggat
aaggctgagtag

DBGET integrated database retrieval system