KEGG   Candida orthopsilosis: CORT_0A09170Help
Entry
CORT_0A09170      CDS       T02488                                 

Definition
(RefSeq) Idp1 isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cot  Candida orthopsilosis
Pathway
cot00020  Citrate cycle (TCA cycle)
cot00480  Glutathione metabolism
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01200  Carbon metabolism
cot01210  2-Oxocarboxylic acid metabolism
cot01230  Biosynthesis of amino acids
cot04146  Peroxisome
Module
cot_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cot_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CORT_0A09170
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CORT_0A09170
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CORT_0A09170
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CORT_0A09170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 14537890
NCBI-ProteinID: XP_003866740
UniProt: H8WYI6
LinkDB All DBs
Position
1:2030053..2031345
Genome map
AA seq 430 aa AA seqDB search
MISASAVNRAKMLSGHIRSFSTSSALSNKIKVKNPIVEMDGDEMTRIIWHKIKDDLIHPY
LDVDLKYYDLGIENRDATSDQVTVDAAHAIQKYGVGVKCATITPDEARVKEFGLKKMWVS
PNGTIRNILNGTVFRESIIIPSVPRFVPGWKKPIVIGRHAFGDQYKATDLVIKEPGTLEL
RFTPDNGGEAQVHKVYQYTSPGVGLAMYNTDESINGFAHASFRMALSKNLPLYMSTKNTI
LKKYDGRFKDIFQEIYDKEYKEQFKKQGLWYEHRLIDDMVAQMIKSQGGFVMALKNYDGD
VQSDIVAQGFGSLGLMTSVLVTPDGSAFESEAAHGTVTRHYRLYQQGKETSTNSIASIYA
WTRGLAQRGRLDNTPEVVEFANKLEKSTIDTVQIDGIMTKDLALTMGKTDRSSYVTTFEF
LDAVANRLKQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatttccgcatcagctgttaaccgtgcaaagatgttgctgggacatattcgttcattt
tccacttcttccgccttatcaaacaaaatcaaggtcaaaaacccaattgttgagatggat
ggtgatgaaatgacaagaatcatatggcacaagattaaggacgatttgattcacccatat
ttggatgttgatttgaagtattacgatttaggaattgaaaaccgtgatgccactagcgat
caagtaacagttgatgctgctcacgcaattcaaaaatacggggtaggtgtcaaatgtgca
accatcacaccagatgaagctagagttaaagaattcggtttaaaaaaaatgtgggtttcg
ccaaatggtacaattagaaatattttgaatggtactgtgttcagagaaagtattattatt
ccaagtgtacctcgttttgttcccggatggaaaaagccaattgttataggaaggcatgca
tttggtgatcagtacaaggctactgacttagtcatcaaggaaccaggtactttggagttg
agattcaccccagacaatggtggtgaagctcaagtacataaggtatatcaatacaccagc
ccaggtgtcggattagctatgtacaacactgatgaatcaatcaatggttttgctcatgca
tcattcagaatggcattgagtaaaaacttgccattgtacatgtctaccaaaaacaccatt
ttgaaaaagtacgatggtagattcaaagacattttccaagagatttacgataaggaatat
aaggaacaatttaaaaagcaaggattatggtatgaacatagattaatcgatgatatggtt
gctcaaatgattaaatcacaaggtggatttgttatggccttgaagaattacgatggtgat
gttcaatctgatattgtcgctcaaggttttggctcccttggtttaatgacttcggtcttg
gttactccagatggatcagcttttgagtcagaagctgctcatggaaccgtcactagacat
tatagattatatcaacagggtaaagaaacatcaaccaattcaattgcatccatttatgct
tggactagaggtcttgctcaaagaggtagattggataatactccagaagttgttgagttt
gccaacaagttggagaagtctaccattgacactgttcaaattgatggaatcatgactaaa
gacttagccttgaccatgggtaagaccgatagatctagttatgtaaccacttttgagttc
ttggatgctgttgcaaacagattgaaacaataa

DBGET integrated database retrieval system