KEGG   Candida orthopsilosis: CORT_0B01340Help
Entry
CORT_0B01340      CDS       T02488                                 

Definition
(RefSeq) Sdh12 succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cot  Candida orthopsilosis
Pathway
cot00020  Citrate cycle (TCA cycle)
cot00190  Oxidative phosphorylation
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01200  Carbon metabolism
Module
cot_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cot_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cot_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CORT_0B01340
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CORT_0B01340
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CORT_0B01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 14538726
NCBI-ProteinID: XP_003867291
UniProt: H8WZI5
LinkDB All DBs
Position
2:complement(279739..281655)
Genome map
AA seq 638 aa AA seqDB search
MLRSLRSKSLSLTRFFSNSSIRSQVQGANVKGSDFNAAKYMGQKYHVVDHEYDCVVVGAG
GAGLRAAFGLAEAGYKTACVSKLFPTRSHTVAAQGGINAALGNMHPDDWHWHFYDTVKGS
DWLGDQDAIHYMTKEAPASIYELERYGVPFSRNEEGRIYQRAFGGQSKEYGKGGQAYRTC
AVADRTGHALLHTLYGQSLNHDCHFFIEFFAMDLMMQDGACIGIVAYNEEDGTLHRFFAN
RTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFVQFHPSGIYGSGCLITEG
ARGEGGFLVNSEGERFMERYAPHAKDLASRDVVSRAITMEINEGRGVGPEKDHMYLQLSH
IPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWQGEVLKKNDQGED
EVVPGLMACGEAACASVHGANRLGANSLLDLVVFGRAVSHTIAGNLKPGEPIKPHSKDIG
YDSINNFDRIRNADGTKTTADIRLNMQKTMQKGCAVFRTQETLDDCVEKINAIDKDFEHV
KTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARKESRGAHARDDYPERDDKEWRKHT
LSYQDAWGSPVRLDYRHVVKHTLDDNDCKPVPPAKRVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatcattacgttcaaaatcattgtcgttgacgagatttttctccaacagctca
attaggtcacaggtacaaggtgctaatgttaaaggttccgactttaatgccgccaaatat
atgggccaaaaataccacgtcgttgaccacgaatacgactgtgtggttgttggtgctggt
ggtgccggtttgagagctgctttcggtcttgctgaagctggttacaaaactgcatgtgtg
tcgaaattgttcccaacaaggtcgcatactgttgccgcacaaggtggtattaatgctgcc
cttggtaacatgcaccctgatgactggcactggcatttctacgatactgttaagggttca
gattggttaggtgatcaagacgctattcattatatgactaaagaagcacctgcttctatc
tatgaattggaacgttatggtgtcccattttcaagaaatgaagaaggaagaatctatcaa
agagcttttggtggtcaatctaaagaatacggtaaaggtggtcaagcttacaggacttgt
gctgttgctgacagaactggacatgctttgttgcacaccttgtacggtcaatcattgaac
catgattgtcacttctttattgaattctttgccatggacttgatgatgcaagatggtgct
tgtattggtattgttgcttacaacgaagaagatggtactttgcacagattttttgccaac
agaactgttattgccactggtggttacggtagagcttacttctcatgtacttctgcccac
acatgtaccggtgatggttatgctatggtttctagagccggtttgcctttggaagatttg
gaattcgttcaattccacccatcgggtatttacggttccggttgtcttattactgaaggt
gctagaggtgaaggtggtttcttggttaattctgaaggtgaaagatttatggaacgttat
gctccacacgccaaggacttggcttcaagggatgttgtttccagagccattactatggaa
atcaatgaaggtagaggtgttggaccagaaaaggatcacatgtacttgcaattgtctcac
attccagccgctgttttgaaggaaagattaccaggtatttcggaaactgcccacattttc
gctggtgttgatgtcaccaaagaaccaattccaatcttgccaactgttcactacaatatg
ggtggtattccaactaactggcaaggtgaagttttgaaaaagaacgaccaaggtgaagat
gaagttgtcccaggtttgatggcttgtggtgaagctgcttgtgcttcggtccatggtgcc
aacagattgggtgctaactccttgttggatttggttgttttcggtagagctgtttctcac
accattgccggtaacttgaaaccaggtgagccaatcaaaccacacagtaaagacattggt
tatgattctatcaataactttgacagaataagaaatgctgatggtactaagaccactgct
gatattagattgaatatgcaaaagactatgcaaaagggatgtgctgttttcagaactcaa
gaaaccttggatgactgtgttgaaaagatcaatgctattgataaagattttgaacatgtc
aagactactgaccgttctatgatttggaacagtgatttggttgaaactttggaattacaa
aacttgttgacttgtgctactcaaactgctgcttcagctgccgctagaaaagaatctaga
ggtgcccacgctagagatgattacccagagagagatgataaagaatggagaaaacacaca
ttgtcataccaagatgcatggggatcaccagtacgtttagattatagacatgttgtcaag
cacactttggatgacaatgactgtaaaccagttccaccagccaaacgtgtttattag

DBGET integrated database retrieval system