KEGG   Candida orthopsilosis: CORT_0B03180Help
Entry
CORT_0B03180      CDS       T02488                                 

Definition
(RefSeq) Sga1 glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cot  Candida orthopsilosis
Pathway
cot00500  Starch and sucrose metabolism
cot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CORT_0B03180
Enzymes [BR:cot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CORT_0B03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 HTH_1
Motif
Other DBs
NCBI-GeneID: 14538208
NCBI-ProteinID: XP_003867466
UniProt: H8X0Y9
LinkDB All DBs
Position
2:681231..682862
Genome map
AA seq 543 aa AA seqDB search
MKLVSILVIVTLNGLINAQLWSYQISPPTAILERYFKFLNFIGLDKTPERTDTASEIPLP
TTSSTTATSTSTTVPPPQFESWLEIQQNTSFRAILQNINQNGVIVASPSKQNPNYYYQWI
RDSAVTVRTLISYLEEHHDNNTKASHSHSQVSNLIELYILNNYKLQRTPNRSGDFANLAG
LAEPKFNVDLTAFNEPWGRPQRDGPGLRAMTIIQFIDYLNRTDGEVIHPELQNSNYIYQK
IIKPDLQYICQYWNESGFDLWEEVDSIHFFTSMVQLKALQMGIRWSKYFQDEDGTFTTKL
INSFDVLKQHIENEFGFVSFGFDHVVESPRLLDSGERLGLDIATILAVIYAHENDDKEQQ
TGEPVANSMPFNVFNPHVLNSISGLIIDMRQRYPINKNRFGVALGRYPEDVYNGIGTSEG
NPWFISTSTASEFIYQFIYNLQIQKSNLVIDDTNRQFFQPLINVTGNEYTLEYNSSDFNS
LITKLVEYADSFLDVVRTHTDSQGRMSEQFNKNTGFMQGAKELTWSYSAVWDAIRWRKKA
LAI
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaagttggtttcaatacttgttattgtcaccttaaacgggttaatcaatgctcagcta
tggtcataccaaatatcgccaccaactgcgatacttgaaaggtacttcaagtttctcaac
ttcattggactagataaaaccccagaacgcacagatactgcatcagaaataccattgcct
actacttcgtcaacaactgcaacttcaacttcaactactgtacctcctcctcaatttgaa
tcatggcttgaaatacaacaaaatacgtcatttcgtgcaattctacaaaacatcaaccaa
aacggagtcattgttgcatctccatcaaagcaaaatcccaactactactaccaatggatt
agggactctgcagttacagtacggacactaatttcatatcttgaagagcaccacgacaat
aatactaaggcttcacattcccacagtcaagtgtccaatttaattgagttatacattttg
aacaactacaagctacaaagaacgccaaatagactgggtgattttgccaatttggcaggg
ttggctgagccgaaattcaatgtggacttgactgcatttaatgagccttggggaagacca
caacgcgacgggcctgggttacgagcaatgacaattattcaatttattgattacttgaat
cgaactgatggtgaagtgattcatcctgaattgcaaaattcaaattacatctatcaaaag
atcatcaaacccgatttgcagtatatttgccagtactggaatgaatctgggtttgatttg
tgggaagaagtcgactcgatccatttcttcacatctatggttcaattaaaggctttgcaa
atgggtataagatggtcgaagtatttccaagatgaggatggtactttcacaacaaagcta
attaactcatttgatgttctcaaacaacacatcgaaaatgaatttgggtttgtttctttt
ggttttgatcatgtggttgaaagcccccggttgttagattcaggtgagagattaggattg
gatatagcaaccatattggccgtgatttacgcacacgagaatgatgataaggagcaacaa
accggtgagccagtagcaaattcaatgccttttaatgtatttaacccccatgtactaaac
tcaatcagtgggttgatcatcgacatgagacaacgatatccaataaacaagaatcgtttt
ggtgttgcattggggagataccccgaagacgtctacaatggaattggcacatctgaaggt
aatccatggttcatatctacttccactgccagtgaattcatttatcaattcatctacaat
cttcaaatacaaaaatcaaacttggtaattgatgataccaaccgacaattcttccaacca
ttgataaacgtcacgggcaacgaatacaccctcgaatacaactcgtctgatttcaattct
ttgatcacaaagttggtggagtatgctgattcatttcttgacgttgttcgtactcataca
gattcacaaggtcgaatgtcagaacaattcaacaagaatacgggattcatgcaaggagca
aaagagttgacctggagttatagcgctgtttgggatgcaattcgttggagaaagaaagca
ctcgctatataa

DBGET integrated database retrieval system