KEGG   Candida orthopsilosis: CORT_0B03610Help
Entry
CORT_0B03610      CDS       T02488                                 

Definition
(RefSeq) Cdc9 protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cot  Candida orthopsilosis
Pathway
cot03030  DNA replication
cot03410  Base excision repair
cot03420  Nucleotide excision repair
cot03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cot00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CORT_0B03610
   03410 Base excision repair
    CORT_0B03610
   03420 Nucleotide excision repair
    CORT_0B03610
   03430 Mismatch repair
    CORT_0B03610
Enzymes [BR:cot01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CORT_0B03610
    6.5.1.6  DNA ligase (ATP or NAD+)
     CORT_0B03610
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CORT_0B03610
DNA replication proteins [BR:cot03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CORT_0B03610
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CORT_0B03610
DNA repair and recombination proteins [BR:cot03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CORT_0B03610
   NER (nucleotide excision repair)
    Other NER factors
     CORT_0B03610
   MMR (mismatch exicision repair)
    Other MMR factors
     CORT_0B03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 14538705
NCBI-ProteinID: XP_003867506
UniProt: H8X129
LinkDB All DBs
Position
2:786744..789026
Genome map
AA seq 760 aa AA seqDB search
MNYLREGRVNLISTLIKRGNYQYRIMAQQQSIARFFGGTASLDAKRKKTSSPPSTQKEST
TTPKNLKSSDPITSPDSSPKLKKQKLNGEENKDDADSKSESNSDSELNNKHASETEAKKL
IELSEFQQKQNKQDRHTLSSSKIPYSSLTDIMEKIESESSRLKITAIISQYFLEILQSQN
EVSKLVKIVYLFINRLGPDYEPDLELGLGETLLVKAISEGYGRTPAKIRQDLKEYGDLGI
VAQKSRSGQRTMFKPTSLDVDTVFDNLTKIAKSTGKDSQSKKIGIINKMLTACDVKHSEA
KFLIRSLENKLRIGLAGPTILVGLAQAFVNYENSKQEKPKRVSPEKLAEAEDIVKEAYTR
IPNYQILIENAYKYGVFNLLDHCKLTPGIPLKPMLAKPTKSMSEVLDRFQDEKFTCEYKY
DGERAQIHLLPNGDVRIYSRNSEDMSQRYPDLISIIREFSKAQEHTSLILDCEAVAWDRI
NKKILPFQVLSTRKRKDVNELDITVHICLFAFDLLYYNNESLLTKSLSERRSIMFTHLHP
LEGKFQFATSKDSTSLEVLQQFLDQSVHDSCEGLMVKMLEGSESYYEPSKRSRNWLKLKK
DYLAGVGDSLDLVVIGAYNGKGKRTGTYGGFLLATYNQDTGDLETTCKIGTGFSDEMLTQ
LYQKLHPSEIPRPKEYFVYDKTNSNAVPDVWFEPTMLFEVLTADLSLSPIYKAAHNEYGK
GISLRFPRFLRIRDDKAIEDATSSTDVAEFYERQAHVQNI
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttaagagaaggcagggttaatttaatatcaacgttaatcaagaggggaaat
tatcaatatagaatcatggcacaacaacaatcgattgcacgtttctttggtggaactgct
tctttagatgctaagagaaagaaaacatcgagtccaccatctacacaaaaggaatccact
acaacaccaaagaacttaaaaagttctgatccgattacatcgcctgattcatcgccaaaa
ttgaagaaacaaaagttgaacggtgaagagaacaaggatgatgctgacagcaaaagtgag
tcgaattctgattctgaattaaacaacaagcacgcttcagagacagaggcaaagaaacta
attgaactaagtgaatttcagcaaaaacagaacaaacaagacaggcacacattatcatca
ctgaaaattccttattcatcattaactgatataatggaaaagattgagtcggaatcatca
cgattgaaaatcacggcaattatatcacaatactttctcgaaattctccaatcacaaaat
gaggtgtcaaaattagtcaaaattgtttatttattcatcaatagattaggtcctgattac
gaacctgatttggaacttggcttaggtgaaacattattggtgaaagctataagtgaagga
tacggacgtacacccgctaaaatcagacaagatttaaaagagtatggagatttaggaatt
gttgctcagaaatcacggagtggacaacgaacaatgtttaaaccaactagtctagatgtt
gatacagtatttgataatttgacaaagattgccaaatccacgggaaaagactcccaatca
aagaaaattggaattattaataaaatgttaactgcttgtgatgttaaacatagtgaagcg
aaatttctaatacgttcattggagaacaaattaagaattggattagctgggcccacgata
ctagttggattagcccaagcatttgtaaattatgaaaatctgaagcaagagaaaccaaag
agggtgagtcccgagaagttagctgaagctgaggatatcgtcaaggaagcatacacaaga
attcccaattatcaaatcttgattgaaaatgcatacaaatatggtgtattcaacttgttg
gaccattgcaaattgacacctggtattcccttgaaaccaatgttggccaaacccactaaa
tcaatgagtgaagtattggatcgtttccaagatgaaaaattcacttgtgaatataaatat
gatggagaacgagctcaaattcatttgttgcctaatggcgatgtacgtatttactcgaga
aattcagaggatatgtcacaacggtatcccgatttgatttctattataagagaatttagt
aaagctcaagaacacacttcattgattttggattgcgaggctgttgcatgggatagaatc
aacaagaaaattttaccatttcaagtactttcgacgaggaaaagaaaagatgttaacgag
ctagacatcactgtccacatttgcctttttgcgtttgatttgctttactacaataatgaa
tctttgttaactaagtcgttactggaaagaagatcaatcatgtttactcatcttcatccc
ttagaaggcaaatttcaatttgccacatcaaaggattcaacttcattagaagtccttcaa
caattccttgatcaaagtgtccatgattcatgtgaaggtctaatggtgaagatgcttgaa
ggttccgaatcgtactacgagccatcgaagagatcacgtaattggttgaaattgaaaaag
gattatttagctggagtgggcgattcattggatcttgttgtcattggtgcatataatgga
aaggggaaacgtacaggaacttatggtgggttcttacttgctacatataatcaagatact
ggagatttagaaactacatgtaagatcggtactgggttcagtgatgaaatgttgacacaa
ttgtatcagaaattgcacccactggagatccctagaccaaaggagtattttgtatatgac
aagacaaactccaatgcagtgcctgatgtgtggtttgagccaacaatgttgtttgaggta
ttgacggccgatttatccttgagtccgatatacaaagcagctcataatgaatatggaaag
ggaatcagtttgaggttccctcggttcttacgaattagagatgataaagcgattgaagat
gctaccagttcaaccgacgttgctgagttctacgaacgtcaagcacatgtacaaaatatt
taa

DBGET integrated database retrieval system