KEGG   Candida orthopsilosis: CORT_0B04070Help
Entry
CORT_0B04070      CDS       T02488                                 

Definition
(RefSeq) Kgd1 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cot  Candida orthopsilosis
Pathway
cot00020  Citrate cycle (TCA cycle)
cot00310  Lysine degradation
cot00380  Tryptophan metabolism
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01200  Carbon metabolism
Module
cot_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cot_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CORT_0B04070
  09105 Amino acid metabolism
   00310 Lysine degradation
    CORT_0B04070
   00380 Tryptophan metabolism
    CORT_0B04070
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CORT_0B04070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 14538771
NCBI-ProteinID: XP_003867551
UniProt: H8X174
LinkDB All DBs
Position
2:complement(882631..885636)
Genome map
AA seq 1001 aa AA seqDB search
MLRAFKRAIPPRTQILRNNVPSLRYNFARIQTRCLATATDTFLQGNDANYVDEMYQQWRQ
DPASVHSSWNAYFTNIEKDGVSPSKAFQAPPTLVPTVSGGTAGFYPQQSNVNEDVVVHLK
VQLLVRAYQVRGHQKAQIDPLGITFGSHAKVPKELTLEYYQFTEKDLDKEITLGPGILPR
FATGGKKSMTLREIIKTCEELYCSSYGVEYVHIPSKEQCDWLRERIEIPQPFKYSQDQKR
QILDRLIWATSFETFLSTKFPNDKRFGLEGAESVVPAMKAMIDTSVEEGIEDVVIGMPHR
GRLNMLSNVVRKPNESIFSEFTGSREFDEGSGDVKYHLGMNYKRPTTSGKHVNLSLVANP
SHLEAEDGVVLGKTRAIQQYKNDVGDFKKAMSILLHGDAAFAAQGVVYETMGFANLPAYS
TGGTIHIIVNNQIGFTTDPRFARSTLYPSDIAKSINAPIFHVNADDVEACTFVFNLAAEW
RAKYHTDCIIDLVGYRKHGHNETDQPSFTQPLMYQEIAKKKSVIDIYTNQLVEEGTFTRE
DIDEHKKWVWNLLEESFSKAKDYQPTSREWLTTPWEDFKSPKELATEVLPHFPTGVDEDT
LKKIGVAISEAPEGFEIHRNLKRILNQRKKAVETGEGIDYSTGEALAYGSLALEGYHVRV
SGQDVERGTFSQRHAVLHDQKSEKTWTPLANLSEDQGVFSISNSSLSEYGVLGFEYGYSL
TSPDALVEWEAQFGDFANTAQVIIDQFVSGAESKWMQRSGVVLSLPHGYDGQGPEHSSGR
IERYLQLCNEDPRYFPSPEKLERQHQDCNMQVAYPTTPANIFHLLRRQMHRQFRKPLILF
FSKSLLRHPLARSNLSEFTGDSQFQWIIEDVLGDKSEVKRLVLCTGQIHSAMHKRREQTK
DNSTAFIKIEQLNPFPFAQLRDALNEYPNIEDLVWAQEEPLNMGAWSFVEPRVHVVLDKT
DKYADLKMRYAGRDPSASIAAGTKAKHLAEEEEILNEVFQH
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgcttagagcttttaaacgtgcaattccaccacgtactcaaatccttaggaacaatgtt
ccttcattgagatacaactttgccagaatccaaaccagatgtttagctacagccactgac
acttttttgcaaggcaatgatgctaactatgttgacgaaatgtaccaacaatggaggcaa
gatccagcaagtgtacattcatcttggaatgcttatttcaccaacattgaaaaggacggt
gtatcgccttcaaaggctttccaagctccaccaactttagttccaactgtttctggtggt
actgctgggttctacccacaacaatcaaatgtcaatgaagatgttgttgttcacttgaag
gttcaattgttggttagagcttaccaagttagaggtcaccaaaaagcacaaattgaccca
ttgggaatcacttttggtagccacgccaaagttccaaaagaattgaccttggagtattat
caatttaccgaaaaggatttggataaagagattacattgggacctggtattttgccaagg
tttgccactggaggaaagaaatccatgactttaagggaaattataaagacatgcgaagag
ttatactgctcttcatatggtgttgaatatgtccatattccctctaaagaacaatgtgat
tggttaagagaaagaattgagattccacagccattcaaatactcacaagatcaaaagaga
caaattttggaccgtttgatttgggctacttcatttgaaacattcttgtcaaccaagttc
cctaatgataagagattcggtttagagggtgctgaatccgttgttcctgcaatgaaggcc
atgattgatacttctgttgaagaaggtattgaagatgttgtcattggaatgccacataga
ggtagattgaacatgttgtcaaacgttgttcgtaagcctaatgaatccatcttttccgaa
tttaccggatcaagagaattcgatgaaggttctggtgatgtcaagtatcacttgggtatg
aactacaagagaccaactacctcaggtaaacatgttaacttgtcattggttgctaaccca
tcacatttggaagctgaagatggtgttgttcttggtaaaacacgtgccattcaacaatac
aagaatgatgttggtgatttcaagaaggcaatgtcaatcttgttacatggtgatgctgca
tttgctgctcaaggtgttgtttacgaaacaatgggttttgccaacttgccagcttactca
actggtggtactatccatattattgtcaataaccagattggtttcactactgatccaaga
tttgctagatctactttatacccatctgatattgccaagagtataaatgccccaattttc
catgtaaatgccgatgatgttgaggcatgtacatttgttttcaacttggctgctgaatgg
agagctaaataccacactgattgtatcattgatcttgttggttacagaaagcatggtcac
aatgaaactgatcaaccatcatttacccaacctctcatgtaccaagaaattgccaagaaa
aagtcagttattgacatctacactaatcaattggttgaagaaggtactttcactagagaa
gatattgatgaacacaagaaatgggtttggaacttgttggaagaatcattctccaaggca
aaagactatcaaccaacttcaagagaatggttaaccactccatgggaagatttcaagtca
ccaaaagagttggctactgaagtattaccacattttccaactggtgttgatgaagatact
ttgaaaaagattggtgttgccatttccgaagccccagaaggttttgaaatacatagaaac
ttgaagcgtatcttgaaccaaagaaaaaaggctgttgaaactggtgaaggtattgattat
tccactggtgaagctttggcttatggttcattagccttggaaggttatcatgttagagtt
tctggccaagatgttgaaagaggtactttttcacaaagacacgctgtcttgcacgatcaa
aaatcagaaaagacttggactccattggctaatttaagtgaagatcaaggtgtatttagt
atatccaactcgtcattatccgaatacggtgttttgggtttcgaatatgggtactcatta
acttcacctgatgctttggttgaatgggaagcacaatttggtgattttgccaacactgca
caagttatcattgatcaattcgtttctggtgctgaatcaaaatggatgcaaagatcaggt
gttgttttatcattacctcatggttacgatggtcaaggtccagaacattcttctggtaga
attgaaagatatttacaattatgtaatgaagatccacgttacttcccatctccagaaaag
ttggaacgtcaacatcaagactgtaacatgcaagttgcttacccaaccactccagctaac
atcttccacttgttgcgtcgtcaaatgcacagacaattcaggaaaccattgattttgttc
ttctccaagtcgttattacgtcatccattagccagatcaaacttgtctgaattcactggt
gactctcaattccaatggattattgaagatgttttgggtgataaatcagaagttaagaga
ctagtattgtgtactggtcaaatccattctgctatgcacaagagaagagaacaaaccaag
gataactcaactgcatttatcaagattgaacaattgaacccattcccatttgctcaattg
cgtgatgcattaaatgaatatccaaatattgaagatttggtatgggcacaagaagaacca
ttgaacatgggtgcttggtcgttcgttgaaccaagagttcatgttgtacttgacaagact
gacaaatatgctgatttgaagatgaggtatgctggtagagatccaagtgcttcaattgct
gctggtactaaagctaagcatttggctgaagaggaagaaatattgaatgaagtatttcaa
cactag

DBGET integrated database retrieval system