KEGG   Candida orthopsilosis: CORT_0B05260Help
Entry
CORT_0B05260      CDS       T02488                                 

Definition
(RefSeq) Ure2 protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cot  Candida orthopsilosis
Pathway
cot00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CORT_0B05260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cot02000]
    CORT_0B05260
Enzymes [BR:cot01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CORT_0B05260
Transporters [BR:cot02000]
 Other Transporters
  Pores ion channels [TC:1]
   CORT_0B05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 Med20 GST_C_2
Motif
Other DBs
NCBI-GeneID: 14538677
NCBI-ProteinID: XP_003867671
UniProt: H8WZN9
LinkDB All DBs
Position
2:complement(1134685..1135620)
Genome map
AA seq 311 aa AA seqDB search
MNSNNGSNQNTHTVSNLSAGLKSVSLSDQQQNELNHNLLQQMQDSSSSQEQQQQQQSRIS
QFFQNQPHEGYTLFSHRSAPNGFKVAIILSELNLPFNTIFLDFNNGEQRAPEFVTINPNA
RVPALIDHYNENVSIWESGAIILYLVSKYMKENNECSLWSDNLVEQSQINSWLFFQTSGH
APMIGQALHFRYFHSSPVPSAVERYTDEVRRVYGVVEMALAERREALIMDLDVENAAAYS
AGTTPLSQSRYFDYPVWLVGDRATIADLSFVPWNNVVDRIGINLKVEFPEVYKWTKYMMR
RPAVIRALRGD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcaacaacggaagcaatcaaaatacacatacggtgtccaacttatctgctggg
ctcaaatcagtgtcgctcagtgatcaacaacaaaatgaattgaatcataatttattgcaa
caaatgcaggatagttcttcatcacaggaacaacaacaacaacaacaatcaagaataagc
caattttttcaaaatcaaccacatgaaggatacaccttgttttcacacagatctgcaccc
aatgggttcaaagtagctataatcttatcagagttgaacttgccattcaatacaattttc
ttagactttaacaatggagaacaacgtgcacctgaatttgttacaataaatccaaacgct
agagttcctgcattgattgaccactacaatgaaaatgtatcaatatgggaatctggtgcc
attatattataccttgtttcaaaatacatgaaggaaaataacgaatgcagtttatggagt
gataaccttgttgagcaaagtcagataaattcatggctattttttcaaacaagtggacat
gcacctatgattggacaagctttgcattttagatatttccattcaagtcctgtccctagt
gcagtagagaggtacaccgatgaagtgaggcgagtttacggagtcgtggaaatggcatta
gcagaaagacgagaggctctaataatggatttggatgtggaaaatgcagccgcgtatagt
gcaggtaccacgccattatcgcaatcgaggtattttgactaccccgtgtggctagtgggg
gatagagctactattgccgatttatcatttgtaccatggaataatgtcgttgatagaata
ggaataaatcttaaagtggagtttccagaagtttacaaatggacaaagtacatgatgaga
agaccagctgttattagagcgttgcgtggagactag

DBGET integrated database retrieval system