KEGG   Candida orthopsilosis: CORT_0B09040Help
Entry
CORT_0B09040      CDS       T02488                                 

Definition
(RefSeq) Sdh1 mitochondrial succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cot  Candida orthopsilosis
Pathway
cot00020  Citrate cycle (TCA cycle)
cot00190  Oxidative phosphorylation
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01200  Carbon metabolism
Module
cot_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cot_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cot_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CORT_0B09040
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CORT_0B09040
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CORT_0B09040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 14539183
NCBI-ProteinID: XP_003868043
UniProt: H8X096
LinkDB All DBs
Position
2:1871216..1873117
Genome map
AA seq 633 aa AA seqDB search
MSVNHTIKRLLTTTSRRCQIIASKIQSNEINSGKIFQRKYRIIDHEYDCVVVGAGGAGLR
AAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHTDNWHWHMYDTVKGSDWLGD
QDAIHYMTREAPASIYELEHYGVPFSRNDEGRIYQRAFGGQTKEYGKGGQAYRTCAVADR
TGHALLHSLYGQSLRHDCHFYIEFFAMDLLMQDGECVGVIAYNEEDGTLHRFRAHKTIIA
TGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFIQFHPSGIYGSGCLITEGARGEG
GFLINSEGERFMERYAPSAKDLACRDVVSRAITMEINEGRGVGPEKDHMYLQLSHIPAAV
LKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWKGEVITKNAEGKDEVVPG
LLACGEAACASVHGANRLGANSLLDLVVFGRAVSHTIRDQLTPHTPLKPMDATLGKESIE
NLHNLRTADGSKSTAEIRLDMQKTMQRGCAVFRTQDTLDTCVKHINEVDKDFATVKTTDR
SMIWNSDMVETLELQNLLTCATQTAAAAAARKESRGAHAREDYPERDDVNWWKHTLTWQS
GFGTDVRIDYRDVIKHTLDEAECKPVPPTVRAY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaaatcacacaattaagcggttgttgacaaccacctcacgaagatgtcaaatt
atcgcttcaaagatccaatcgaatgagataaattcgggtaaaattttccagcgtaaatat
cgtattattgaccacgagtacgattgtgttgttgttggagctggtggagcgggtcttcga
gcggcatttggcttagcggaggcagggttcaatacggcttgcgtgtcaaagctttttcct
actagatcacatacagtagctgcacaaggtggtatcaacgcagctctagggaatatgcac
accgataattggcattggcacatgtatgatacagtcaaaggatccgattggttgggcgat
caagatgccattcactatatgaccagagaagccccggcatctatttacgaattggagcat
tatggagtaccgttttcaaggaatgatgagggtagaatctatcaaagagcatttggagga
cagactaaggagtacgggaaggggggtcaggcgtataggacatgcgcagtggctgaccgt
accggtcatgcattgttgcattctctctatggtcagtctttgagacatgactgtcatttc
tacattgaattctttgccatggacttgttgatgcaagatggcgagtgtgtcggagtgatt
gcttacaatgaagaggatggtactttacatcgattcagagcgcataaaacaattatagca
acaggaggatatggtagggcctatttttcatgtacttctgcacacacttgtaccggtgat
ggttatgctatggtttcacgagcaggattaccattggaagatttggagttcattcaattc
catccctcagggatatatggatccggatgcctcatcactgagggtgcaagaggtgaaggg
gggtttttaatcaattccgaaggtgaacgttttatggaacggtatgctccttcagccaaa
gatttggcttgtagggatgtcgtatctcgtgccatcacaatggagatcaatgagggaaga
ggtgttggtccagaaaaagatcacatgtatttgcaattatctcacattccagctgctgtt
ttaaaggaaaggttgccaggtatatctgaaaccgcacatatatttgcaggcgttgatgtt
acaaaagaaccaattcctattttgccaaccgttcactataacatgggtggtattcctact
aattggaaaggcgaggttatcacaaagaatgcagaagggaaagatgaagtagttccagga
ttattagcttgtggggaagctgcatgtgcttcagtacatggagccaacagattgggtgct
aactccttgttggatttggttgtatttggtcgagctgtttctcacacaatccgagaccaa
ttgacgcctcataccccattgaaacctatggatgccacattgggaaaagagtcgattgaa
aatttacacaacttgcgcactgctgatggttcaaaatcgacggctgaaattaggttggat
atgcagaaaacaatgcaaagaggatgtgctgttttcagaacacaagatacattagacact
tgtgttaaacatataaacgaggttgacaaagactttgccaccgtgaaaacgaccgaccgc
tcaatgatttggaatagtgatatggtggaaactttggagttgcaaaacttgctcacttgt
gctactcaaacagcagcagcagctgctgcaagaaaagaatcgagaggcgctcatgccagg
gaggattatcccgagcgagatgatgttaattggtggaaacacacgttgacttggcaactg
gggtttggtaccgatgttaggattgactacagagatgtcattaagcacacattggatgaa
gctgagtgtaagcctgtgccaccaactgtaagagcatattag

DBGET integrated database retrieval system