KEGG   Candida orthopsilosis: CORT_0D06160Help
Entry
CORT_0D06160      CDS       T02488                                 

Definition
(RefSeq) Hxk2 hexokinase II
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cot  Candida orthopsilosis
Pathway
cot00010  Glycolysis / Gluconeogenesis
cot00051  Fructose and mannose metabolism
cot00052  Galactose metabolism
cot00500  Starch and sucrose metabolism
cot00520  Amino sugar and nucleotide sugar metabolism
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01200  Carbon metabolism
Module
cot_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cot_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CORT_0D06160
   00051 Fructose and mannose metabolism
    CORT_0D06160
   00052 Galactose metabolism
    CORT_0D06160
   00500 Starch and sucrose metabolism
    CORT_0D06160
   00520 Amino sugar and nucleotide sugar metabolism
    CORT_0D06160
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CORT_0D06160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cot04131]
    CORT_0D06160
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CORT_0D06160
Membrane trafficking [BR:cot04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CORT_0D06160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 PqqD
Motif
Other DBs
NCBI-GeneID: 14540499
NCBI-ProteinID: XP_003869587
UniProt: H8X5J6
LinkDB All DBs
Position
4:complement(1246790..1248247)
Genome map
AA seq 485 aa AA seqDB search
MVHLGPKPPQHRKGTFTDVPPELLKVVKDLEQEFSVSGETLRKIVDHFITELDKGLSKKG
GNIPMIPGWVMDYPTGEETGDYIAIDLGGTNLRVVLVKLGGNRDFDTTQSKFPLPEHMRT
AKSEELWSFIADCLKKFVDDLYPEGCKEPLPLGFTFSYPASQNSITEAVLQRWTKGWAIE
GVEGKDVAPMLQDAIKKVGVPIKVVAIINDTVGTLVASRYTDPEAKLGLIFGTGVNGAYY
DVVKDIPKLEGKTADDVDPDSPMAINCEYGSFDNELVVLPRTKYDVRVDKESPRPGQQSF
EKMNSGYYLGELLRLVLLDLTEERHLIFKGQSLDKLNEPYILDTSFPAKIEEDPFENLED
VAELFQAQLGIQTTVAERKVIRRIAELIGERSARLSVCGIAAICKKRGYKTAHCAADGSV
YQKYPEFKTRAAKSLRDIFQWPDDLKEDPIVIVPAEDGSGVGAAIIAALTENRLKEGKSV
GVRKN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttaggccccaaacctcctcaacatagaaaaggtacattcacagatgttcca
ccagaattattaaaggtggtgaaagacttggaacaagaattttcagttagtggtgaaaca
ttgagaaaaattgttgatcatttcattactgaattagataaaggattatccaagaaaggt
ggtaatatccctatgattcctggttgggttatggattaccccactggtgaagaaacaggt
gattacattgccattgatttaggtggaacaaacttgagagttgttttggttaaattgggt
ggaaatagagatttcgataccactcaatcaaaatttcccttaccagaacatatgagaact
gccaagagtgaagaactttggtcatttattgctgattgtttgaaaaaatttgttgacgac
ctttatccagaaggttgtaaagaaccattacctttgggtttcacatttagttaccctgca
agtcaaaacagtatcactgaggccgtattgcaaagatggaccaaaggttgggcaattgaa
ggagttgagggtaaagatgttgctccaatgttgcaagatgctataaagaaagttggtgtt
ccaatcaaagtagtggctattatcaatgatactgtgggaactttggttgcatcaagatat
actgatccagaagccaaattgggattgatttttggaactggtgtcaatggtgcttactac
gatgttgtcaaagatattccaaaattggaaggtaaaactgctgatgatgtggacccggat
tcaccaatggctatcaattgtgaatatggatcttttgataatgagttggtggttcttcca
agaactaaatatgatgttagagttgataaagaatccccaagaccaggccaacaatcattt
gaaaagatgaactcaggatattatcttggtgaacttttgagattagtattgttggacttg
actgaagaaagacaccttatctttaaaggacaaagtttggataaattgaacgaaccatac
attttagacacatcattcccagccaagatagaagaagatccatttgaaaatttggaagat
gttgccgaattattccaagctcaattgggtattcaaaccactgttgctgaacgtaaagtg
attcgtcgtattgctgaattgataggagaaagatcggcaagattatcagtttgtggtatt
gcagcaatctgcaagaaaagaggttacaagactgctcattgtgctgctgatggatcagtt
tatcagaaatatcctgaattcaaaaccagagctgcaaagagtttaagagatatttttcaa
tggccagatgatttgaaagaggatccaattgttattgttccagctgaagatggcagtggt
gttggtgcagccatcattgctgcattgactgaaaacagattgaaagaaggtaaatccgtt
ggtgttagaaagaattaa

DBGET integrated database retrieval system