KEGG   Candida orthopsilosis: CORT_0D07340Help
Entry
CORT_0D07340      CDS       T02488                                 

Definition
(RefSeq) cysteine sulfinate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cot  Candida orthopsilosis
Pathway
cot00250  Alanine, aspartate and glutamate metabolism
cot00410  beta-Alanine metabolism
cot00430  Taurine and hypotaurine metabolism
cot00650  Butanoate metabolism
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
Module
cot_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CORT_0D07340
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CORT_0D07340
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CORT_0D07340
   00430 Taurine and hypotaurine metabolism
    CORT_0D07340
Enzymes [BR:cot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CORT_0D07340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 14540108
NCBI-ProteinID: XP_003869700
UniProt: H8X6F6
LinkDB All DBs
Position
4:1520639..1522165
Genome map
AA seq 508 aa AA seqDB search
MTIESDLEKNRVEELDHLLTLIKPKILQYIAEADPNSSKYKASSLGTYHEPSFLKQELIN
DSDNNLMKPANEDQLWEIIDKVLAYSVNTWNPGFLDKLYASNNPIGVISDIILSVLNTNS
HVYTVSPVLSVLENYIGKKYASLFFTDNLQTCGGLTFSGGSWSNITSMQIARSMKFPSTK
QHGNGDHKFAIYTSKHCHYSVVKGAILLGLGSENVFKVDVTKEGTLKVDDLEKVIEQSIE
DGYTPLYINSTAGTTVFGSYDPFEEIAKVAKKYNIHFHIDGSWGGNVVFSPTYKDRLAGC
QYADSITVNPHKMLGVPTTCSFLLIPHVAHFQTAMSLQAPYLFHGRDNDDDENYDLADGT
MGCGRRADSFKFYLSWLYYGQIGFQHRVDHAYKIQEHFVSRITSYPGDVFELVGPKTPQC
LQVCFYYHPPSVKGDKSSGSAGERNTEVTRYISRELHKQGKYLVDFSPNPEDESQGEFFR
VVFNSPILSDKVVDDLIESIVTVGQELQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaatcagatttggaaaaaaatagagttgaagaattagaccacttgcttact
ttaattaaaccgaaaatccttcaatacattgcagaagccgatcctaattcgtctaaatat
aaagctagctcattagggacataccatgaaccaagttttttaaaacaggaattaatcaat
gatctggataataatttaatgaaaccagctaatgaagatcaattatgggagattattgat
aaagtattggcgtattctgtcaacacctggaaccctggctttttagataaattatatgct
tcaaataaccccattggtgtcatttccgatatcattttaagtgtattgaatacaaattct
catgtgtatacagtctcaccagtgttgtcggtgttggaaaattatattgggaaaaagtat
gcttcgttgttcttcaccgataatttacaaacttgtggtgggttgactttcagtggtgga
tcatggtctaatatcactagtatgcaaattgcccgaagtatgaagtttcccctgactaag
caacacgggaatggtgatcataagtttgccatatatactagtaaacattgtcattattca
gtcgtcaaaggagctattttgttgggattaggaagcgaaaatgttttcaaagttgatgtg
actaaggagggcactttgaaagtggatgacttggaaaaagttattgaacagtcgattgag
gatggatatactccattatatataaattccactgcaggaactacagtgtttggatcatat
gacccattcgaagagattgctaaagtggctaagaagtacaatatccatttccatattgat
ggatcatggggtggtaatgttgtattctcacccacatacaaagatcgattagccggatgc
caatacgctgattcaataactgtcaatccacataagatgttgggtgtaccaacaacttgc
tcttttttacttatccctcatgtggcccatttccaaacagcaatgtcattacaagcgccc
tatttgtttcatggtcgtgataatgatgatgatgaaaattatgatttggccgatggaact
atgggatgtggacgtagagctgatagctttaaattttatttgagttggttgtattatgga
caaattggattccaacatcgtgttgatcatgcgtacaagattcaagagcatttcgtgagt
aggattacttcctatcctggtgatgtgtttgaacttgtgggtccaaaaacaccgcaatgt
ttacaagtttgtttttattatcacccgccatcggtaaaaggagataagtccagtggttct
gctggtgagaggaatactgaagtaacgagatatatctccagagagttgcataaacaaggc
aagtatttggttgatttcagtcctaatcctgaagatgaatcacaaggagaatttttccga
gttgtttttaattcacccatattgagtgataaagtagttgatgatttgattgaaagtatt
gtgacagttggtcaagagttgcaataa

DBGET integrated database retrieval system