KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1881Help
Entry
Cp162_1881        CDS       T02154                                 

Gene name
oppCD1
Definition
(GenBank) Oligopeptide transport system permease protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02034  peptide/nickel transport system permease protein
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cou00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cp162_1881 (oppCD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cou02000]
    Cp162_1881 (oppCD1)
Transporters [BR:cou02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Cp162_1881 (oppCD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran BPD_transp_1 AAA_21 oligo_HPY SMC_N AAA_22 AAA_29
Motif
Other DBs
NCBI-ProteinID: AFM08192
LinkDB All DBs
Position
complement(2119519..2121195)
Genome map
AA seq 558 aa AA seqDB search
MSKQAKSPVVMHVQKWAKYHRISISVFIGVVLYGLLIPVFFDAGSPSFSKALKSPSSTNL
FGTDHFGFDLFVRTAESLRVSLVIGSLSALVATALGVIVGLIAAAVGGRTDRIIMRLNDA
VNSIPHLILSVVIVALFRGSLIAIVLSIALTHWSPVARIVRSSVLAVRTSDYVDASYAAG
GPFKWVLIRHLAPAAAGQAVVAMIMLMPHAVWHESALSFLGLGIQADEPSLGTLMDLARE
DIMRGAWWALVFPAAVLLTTTLSAVSLARKVPEVVIDVDVTETEEQVETDVVAPSDGMEV
HNVSVVVHGKDATQQRILKDASLHVEAGSIHGLIGASGSGKTTLGKSIVGIAPQYSKLVG
RVSVAGKPLAWGEKDFSKIRGTVVGFVPQSAAQSFTPVRRLGTQLQEIIDRHQGTYSVSD
LLRTVHLPEGSAEFFPHQLSGGMAQRAAIAAALAGNPTYLIADEPTSALDPQLTSDILAL
FKEIADSRGVGILIISHDIEDLRESEICDTVSVMRDGEIMETGPADKVLHTPDHEYTRAL
LAALPSGGLKVTEGLERG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaagctaaatctcccgtggtaatgcacgtgcaaaagtgggccaagtaccat
cgcatcagcatctctgtttttatcggagttgttctgtatggattattgattccagtcttt
tttgacgctggaagcccgagcttttctaaggccctgaagtctccgagctctactaatttg
tttggtactgaccactttggctttgatctttttgtccgcacagcggagagcctgcgggtc
tcgctggtcatcggctcattgtctgctctagtggcaaccgcgctgggagtgatcgtcggg
ctgattgcggctgcagtaggtggacgcacggatcgcataatcatgcgcctcaatgatgcg
gtgaactcgattcctcatctgattctttcggtggtcatcgtcgcattgttccgtggatcg
ctcattgcaattgtgctgtctattgcgttaacgcactggtccccggtcgcgcgtattgtt
cgttcttcagtactagccgtacgaacttccgattatgtggacgcctcttatgccgctggt
ggccctttcaaatgggtgcttattaggcatttagctcccgcagcagctggtcaggctgtg
gttgccatgatcatgctgatgccgcacgcggtgtggcacgagtctgcgttgtcattcttg
ggactgggcatccaagcggacgaaccgtctttgggtactctcatggatctagcccgtgaa
gatattatgcgtggtgcctggtgggcgctagtattcccagccgcagtattgttgaccact
acgctttccgcagtgtcgttggcacggaaagtgcctgaagttgttatcgacgttgatgta
accgaaacagaggaacaagtagaaaccgatgtggttgcgccaagcgacggcatggaagtc
cacaacgtgagcgttgtagtccatgggaaagacgccacgcagcagcgtattctcaaagac
gcatctttgcatgtagaggctggttctattcacggtctgattggggcctcgggatcgggc
aaaactactttaggtaagtcaatcgtgggaatcgctccccagtattccaagctcgtagga
cgcgtgagcgtcgctgggaaaccgctggcctggggggagaaagacttttctaagatccgg
ggaaccgtggtcggttttgttccgcaatctgcagcgcaatcttttacacctgtgcgtcgt
ttgggtactcaattacaagagattattgaccggcaccagggaacctatagcgtatcggat
ctgctgcgcacagttcatctgccagagggaagcgcggagtttttcccgcatcagctttct
ggaggcatggcgcaacgcgcagctattgcggctgctctggctggtaaccctacgtatctt
attgccgatgagcccaccagcgcattggacccacagctaacctccgatattttggcgcta
ttcaaagagattgcagattctcggggcgtgggaatcctaataatcagccatgacattgag
gatctgcgagaatccgagatttgtgacactgtctccgtgatgcgagatggcgagatcatg
gaaactggtcccgccgacaaggtattgcacacgcctgatcatgagtacacgcgcgccctg
ctagcagcgctacctagtggtgggttaaaagttacggaaggacttgagcgtggataa

DBGET integrated database retrieval system