KEGG   Colwellia sp. Arc7-635: EKO29_13810Help
Entry
EKO29_13810       CDS       T06022                                 

Gene name
megL
Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
cov  Colwellia sp. Arc7-635
Pathway
cov00270  Cysteine and methionine metabolism
cov00450  Selenocompound metabolism
cov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cov00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EKO29_13810 (megL)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EKO29_13810 (megL)
Enzymes [BR:cov01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     EKO29_13810 (megL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 SelA Tae4 GDC-P
Motif
Other DBs
NCBI-ProteinID: AZQ84968
UniProt: A0A3S9Q7R3
LinkDB All DBs
Position
3190691..3191902
Genome map
AA seq 403 aa AA seqDB search
MSESKNIETQAIHSGRINDEQFGSLATPLYQTSTFIFENAQQGADRFAGEAEGYIYSRLG
NPTTRQLEMRVAAMEGMEDAAATATGMGAVSGALLANLSCGDHLISSKAVYGCSFALMSH
QLTRWGIEVSFVDMANPAEVEAAIKPNTKVMFLETPVNPNLAVYDLAVIGKIAQKNNIIS
IVDNTFLTPVLQQPRKYGIDIVVHSATKYLNGHGDVVAGIICGTNEMIMNIKMTVLKDIG
ATMSPHDAWLIMRGLKTLPIRMERHCSNAEKIAEYLQTHESVSQVYYPGLKSHPGNKFIG
SQMKAAGGVIAFEIKSDLSGGSEFINRMQLFSIAVSLGDAESLIQHPASMTHSPYTQEER
LAAGISDSLIRISVGLENVDDLLADLEQSLNMIKQESVVKSVA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagtaaaaatattgaaacacaagccattcattctggtcgtattaatgatgaa
caatttggctcattagcaacgccactttatcaaacctcgacatttatctttgaaaatgca
caacagggtgctgataggttcgctggtgaagcggaaggttatatttatagccgcttaggt
aatccaaccacacgacagttagaaatgcgcgtagccgcaatggaaggaatggaagatgcc
gcagcaacagcaactggcatgggcgcagtttcaggtgctttactcgccaacttatcttgt
ggggatcatttgatctcatcaaaagcggtttatggttgctcatttgcgctgatgagtcac
caattgactcgttggggaatcgaagtcagttttgttgatatggcaaatcctgcagaagtt
gaagctgctataaaaccaaatactaaggttatgtttttagaaacaccggttaaccctaat
ttagcggtatacgatttagccgtaatcggtaaaatagcgcaaaaaaacaatataatttct
atcgtcgacaatacctttttaactcccgttttacagcaaccacgaaaatatggcattgat
attgttgtgcatagtgcgaccaaatatttaaacggtcatggtgatgtagttgctggcatt
atatgcggcacgaacgagatgatcatgaatatcaagatgacggtattaaaggatattggt
gccacaatgagtccccatgatgcttggctaattatgcgcggccttaaaacattgccgatc
agaatggaacgtcattgtagtaatgctgaaaagattgcagagtatttacaaactcacgaa
agtgtttcgcaagtctactatccaggcttaaaaagccacccaggtaataagtttattggc
tcacaaatgaaagccgctggtggtgtcatcgcatttgaaataaagagtgatttatctggt
ggtagtgaatttattaaccgcatgcaattattttcgatcgcagttagtttaggcgatgct
gaatcacttattcaacatcctgcatcgatgactcattctccttatacacaagaggaacgc
ttagcggcaggtataagcgatagtttaattagaatttctgtcggtttagaaaatgttgat
gatctattagcagatttagagcaatcgctgaatatgataaagcaagaatccgtagttaaa
agcgttgcataa

DBGET integrated database retrieval system