KEGG   Caldicellulosiruptor owensensis: Calow_0606
Entry
Calow_0606        CDS       T01347                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00970  Aminoacyl-tRNA biosynthesis
cow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calow_0606
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_0606
Enzymes [BR:cow01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Calow_0606
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Calow_0606
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_0606
SSDB
Motif
Pfam: Amidase sCache_2 Prefoldin
Other DBs
NCBI-ProteinID: ADQ04182
UniProt: E4Q4U0
LinkDB
Position
700157..701617
AA seq 486 aa
MLYKLTAHEAIELIKRKEVKCQEVVESVLERIKQVEDKVKSYITITEEQALENAKKIDEK
IAKGEDVGALYGLPIALKDNLCTDGIRTTCASKILYNFVPPYDATVVKKLKENHMTLLGK
LNMDEFAMGSSTENSAFHTTKNPWDLERVPGGSSGGSAAAVAADEAFFTLGSDTGGSIRQ
PASLCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTKDVEDCALAMNIICGHDPYDATSA
PIEVPDFTKALINDVKGLKIGVPREYMEKGVNDEVKKAIEKALELLKSLGAQYEEFSIPI
VEYALPTYYIIASSEASSNLARYDGIKYGYRTQNYDDLIDLYKKTRSEGFGAEVKRRIML
GTYALSAGYYDAYYKKGLQVRTLIKRAFDEAFQKYDVIITPTSPTTAFKIGEKVSNPLEM
YMSDICTVPVNIAGLPAISIPCGVDSNNLPIGLQIIGKAFDEETIIRVAYTFEQNSGYRN
LKPQNL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgctctacaaactgactgcacatgaagcaattgagcttataaagagaaaagaggtcaag
tgccaagaggttgttgaaagtgttcttgagagaattaaacaggttgaagataaagtaaag
tcttatataacaattacagaagagcaggctttagaaaatgcaaaaaagattgacgagaaa
attgcgaaaggtgaggatgttggagctttgtacgggcttccaattgctcttaaagacaac
ctgtgcacagatggaattaggacaacctgtgcatctaaaattctttataactttgtccca
ccatacgatgcaactgttgtaaaaaagctaaaagaaaatcacatgacacttttaggcaag
ctcaatatggacgagtttgcaatggggtcatcaacagaaaactctgctttccacacaaca
aaaaatccctgggatttagaaagagttccgggaggttcatcaggtgggtctgctgcggct
gttgcagcagatgaagcattctttactcttggttctgacacaggtggttctataaggcaa
ccagcttccctttgtggagttgttggtatgaagcccacgtatggaagagtttcgcgattt
ggacttgttgcatttgcatcttctcttgaccagataggacctttgacaaaagatgttgag
gattgtgctttagctatgaatattatatgtggacatgacccatatgatgcgacatcagca
ccaattgaagttcctgactttacaaaggctcttataaacgatgtaaaagggctcaagata
ggagttccaagggaatatatggaaaaaggagtaaacgatgaggtaaaaaaagctattgag
aaagcgcttgagcttttaaaatctcttggtgcacagtacgaagagttttcaataccaatt
gtggagtatgctcttccaacttactacattattgcttcatctgaggcaagctcaaactta
gcaaggtatgatggaatcaagtatgggtacagaacacaaaactatgacgacctgatagat
ttatacaaaaagacaaggtcagagggatttggtgcagaagtaaaaagaaggattatgctt
ggaacgtatgcgctttctgctggatactatgatgcatactacaaaaaaggacttcaggta
agaacattgattaagcgggcatttgatgaagctttccaaaagtatgatgttattatcaca
ccaacaagtccaacaactgcattcaaaattggcgaaaaggtatcaaatccgcttgagatg
tatatgtcagatatatgcacggtgccagttaacattgcaggacttccggctatttcgata
ccatgtggggttgattcaaataatctacctatcggattgcaaatcattggaaaagctttt
gatgaggaaacaataataagagttgcatatacctttgaacaaaacagcggatatagaaac
ttaaaacctcagaatttataa

DBGET integrated database retrieval system