KEGG   Caldicellulosiruptor owensensis: Calow_0726
Entry
Calow_0726        CDS       T01347                                 

Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calow_0726
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cow01007]
    Calow_0726
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cow03016]
    Calow_0726
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_0726
Enzymes [BR:cow01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Calow_0726
Amino acid related enzymes [BR:cow01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Calow_0726
Transfer RNA biogenesis [BR:cow03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Calow_0726
 Prokaryotic type
    Calow_0726
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_0726
SSDB
Motif
Pfam: tRNA-synt_1b S4 S4_2 TyrRSs_C
Other DBs
NCBI-ProteinID: ADQ04298
UniProt: E4Q5K3
LinkDB
Position
832035..833225
AA seq 396 aa
MDIEHQLKVFKKGAAEIITEEELVEKLKQDRPLNIKLGLDPNVPDVHLGHAVVLRKLKQL
QDLGHNIILIIGDFTAMIGDPTGKSETRKQLTKEEVQKNAEPFKQQVLKILDPKKTTVRY
NSEWLEPMNFLDVINLASKYTVARMLERETFKQRMEKNLPLSIHEFFYPLMQGYDSVVIE
ADVELGATEQKFNILMGRTLQKEYGCKTIQVALLMPILVGTDGVNKMSKSLGNYIGINEP
PNIMYGKVMSIPDEIMISYYELTTDLEPEEIEEMKRKLEEGTLHPRDAKMRLAREIVKLY
HGEEAAIRAEEEFIKVFQKKDIPDNIPEVELQSSKVYLPRFMVENKLCSSTSEGMRLIKS
GAVKLNGEKVNDLDIELQNGDVLQVGKLKFVKVKLL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggatatcgaacatcaattgaaggtttttaaaaaaggtgctgctgagataattacagaa
gaggagcttgttgaaaagttaaagcaagacagacctttaaacataaaacttgggcttgac
ccaaacgtgccagacgttcatcttggacatgctgtggttttgaggaaacttaaacagctt
caagaccttggacacaatataatcttgataattggtgattttactgcaatgattggtgac
ccgacaggaaagtcggagacaagaaaacagcttacaaaagaagaggtccaaaaaaatgca
gaacctttcaaacagcaggttttaaagatattagacccaaagaagacaacagtcagatac
aacagcgaatggcttgagcctatgaacttcttggatgttataaacttggcatcaaaatac
acagttgcaagaatgcttgaaagagagacatttaagcagagaatggaaaagaacttgcca
ctctcaatacatgagtttttctacccgcttatgcaggggtatgactctgttgttatagaa
gccgatgttgagcttggcgcaacagaacagaaatttaatattctaatgggaagaactctt
caaaaagaatatggttgcaagactattcaggttgcgcttttgatgccaattttggttggt
acagatggtgttaataagatgagcaagagccttggaaactatattggaataaatgaaccg
ccaaatataatgtatggaaaggtaatgtcaatccctgatgagattatgatttcgtactat
gaactaacaaccgatttagagcctgaagagattgaagagatgaaaagaaagcttgaagaa
gggacccttcatccaagagatgcaaagatgagacttgcaagagagattgtaaagctctat
catggcgaagaggcggcgataagggctgaagaagaattcataaaagtgttccagaaaaaa
gacataccagacaacattcctgaggttgagcttcaaagctcaaaggtgtatttgccaagg
tttatggtagaaaataagctctgctcatctacgagtgagggaatgagacttatcaaaagc
ggtgctgttaaactcaacggtgagaaggtaaatgaccttgacattgaacttcaaaacggc
gatgttttgcaggtaggcaagctaaaatttgtaaaagtaaagcttttgtga

DBGET integrated database retrieval system