KEGG   Caldicellulosiruptor owensensis: Calow_0752
Entry
Calow_0752        CDS       T01347                                 

Definition
(GenBank) ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Calow_0752
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cow03011]
    Calow_0752
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_0752
Ribosome [BR:cow03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Calow_0752
  Bacteria
    Calow_0752
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_0752
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: ADQ04322
UniProt: E4Q5M7
LinkDB
Position
860978..861223
AA seq 81 aa
MAVRIRLKRMGAKNNPFYRIVVADSRTPRDGKTIDEIGYYNPLKNPAEIKVDVERAKKWL
SNGAQPTDTVKILLKKAGVIE
NT seq 246 nt   +upstreamnt  +downstreamnt
gtggcagtaagaataaggctcaagagaatgggtgcaaaaaacaatcctttttatagaatt
gttgttgcggattcaagaacgccaagagatggaaaaacaattgatgagattggttattac
aatcctctaaaaaatccagctgaaataaaggtggatgttgagagagctaaaaaatggctt
tcaaacggtgctcagccaacagatacagttaaaattctacttaaaaaagctggtgtgatt
gaataa

DBGET integrated database retrieval system