KEGG   Caldicellulosiruptor owensensis: Calow_1045
Entry
Calow_1045        CDS       T01347                                 

Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calow_1045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cow01007]
    Calow_1045
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cow03016]
    Calow_1045
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_1045
Enzymes [BR:cow01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     Calow_1045
Amino acid related enzymes [BR:cow01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Calow_1045
Transfer RNA biogenesis [BR:cow03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Calow_1045
 Prokaryotic type
    Calow_1045
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_1045
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f DZR zf-ACC tRNA-synt_1d TackOD1 Pathogen_betaC1
Other DBs
NCBI-ProteinID: ADQ04608
UniProt: E4Q149
LinkDB
Position
1129802..1132255
AA seq 817 aa
MEYNFKEIEKKWQQKWFSQNKYKVSEDSPKPKYYVLEMFPYPSGKLHMGHVRNYSIGDVF
ARFMRLKGYNVLHPMGWDAFGLPAENAAIKHGIHPSDWTWSNIQNMKRQLMELGISYDWD
REVATCHPDYYKWTQWMFLQFYKAGLAYRKRSYVNWCPSCETVLANEQVVNGRCERCKSL
VGKKDLEQWFFRITNYAERLLRDIEKLDGWPEKVKIMQKNWIGRSEGAEIEFEIEGLGKK
IKVFTTRPDTLFGVTYLVLAPEHPLTKEIIAGKPQEKECLEFIEKMQYLNEIERTSTEIE
KEGRFTGGYAIHPLTGERVPIYIANYVLVDYGTGAVMGVPAHDQRDFEFAKKYNLPIKVV
IKGEGVDIENLQSAYEDEGVLINSGIFDGLKNTDAMKKITQYLEQKGVGRACVTYKLRDW
LISRQRYWGAPIPIVYCDECGIVPVPEEDLPVLLPYNVEFKPTGQSPLSYCEEFVNTTCP
KCGRPAKRETDTMDTFICSSWYYFRYTDPKNDQKPFEKSLVSYWLPVDQYIGGVEHAILH
LLYSRFFTKVLYDLGYVPFEEPFKNLLTQGMVLKDGAKMSKSLGNIVSPEDIIEKYGADT
ARLFILFAAPPERDLEWSDQGVEGCFRFLNRLWRLYIELKNKLADDNLVGESELDDELRY
RLNYTIKKVTEDIGERFNFNTAISTIMELLNFLYEYKESGKLNKDLIIDTLRNLLILIYP
FTPHIACELWEVMGFGEDIEEVSWPQYDEAALVRKNVEIAIQVNGKVRSRMNISVDMTED
EVKQAVLNDQKLKSLLDGKEIVKFVYVKNRLVNIVVK
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggaatataattttaaagagattgaaaagaaatggcagcaaaaatggttttcacagaac
aaatacaaagtatcagaggacagtccaaaaccaaaatattatgtccttgagatgtttcca
tatccttcaggaaaacttcatatggggcatgttaggaactattcaataggtgatgtgttt
gcacgttttatgaggttaaagggctacaacgttttgcatccgatgggttgggatgcgttt
ggtcttcccgctgaaaatgctgctataaagcatggaattcatccttctgactggacatgg
tcaaacattcagaatatgaaaaggcagcttatggaacttggaattagctatgattgggac
agagaagtagcaacatgccatcctgattattataaatggacacagtggatgttcttgcag
ttttataaagctggacttgcttatagaaagagatcatatgtgaactggtgtccatcctgt
gagactgtgcttgcaaatgaacaggttgtaaatggtagatgtgaaagatgtaaatcactt
gttggtaaaaaagatttagagcagtggtttttcaggattactaactatgccgaaaggctt
ttacgtgatatagaaaaacttgatggttggccagagaaagtaaaaataatgcagaagaac
tggataggaagaagtgaaggtgcagaaattgagtttgaaattgaaggcttgggtaagaaa
ataaaagtgtttactacaaggcctgataccctttttggtgtcacataccttgttttggct
ccagaacatcctttaacaaaggagataatagcaggaaaacctcaggagaaagagtgtctt
gagtttatcgaaaagatgcaatatctaaatgagattgagagaacttctacagagatagaa
aaagagggaaggtttactggtgggtatgctatccatcctctaacaggtgaaagagtgcca
atatacattgcaaactatgtgctggttgattatggaacaggggctgtaatgggtgttcca
gctcatgaccagagggactttgagtttgctaaaaagtataatcttcctattaaagttgtg
ataaaaggtgaaggtgttgacattgaaaatcttcagagtgcttatgaagatgagggtgtt
ttgattaattctggaatttttgatgggcttaaaaacacagatgctatgaaaaagataaca
cagtatctggaacaaaaaggtgttggcagggcatgtgtaacgtataaactcagagactgg
ttaatatccaggcaacgttattggggagctccaattcctattgtatattgtgatgaatgt
gggattgttcctgtacctgaggaagatttgcctgttttgctaccttacaatgttgagttc
aaaccaacaggccagtcaccactttcttactgtgaagagtttgttaacaccacatgtcca
aagtgcggaagacctgcaaagagagaaactgatacaatggacacgtttatatgttcctcg
tggtattattttagatacactgaccccaaaaatgatcaaaaacctttcgaaaaatcgctt
gtttcttactggcttcctgttgaccagtatattggcggggttgaacatgctatattgcat
cttctatattcgaggttctttacaaaggtgctatatgaccttggctatgtaccttttgaa
gagcctttcaagaacctcttgacgcaaggcatggtgttaaaagatggagcaaagatgtca
aaatcgcttggaaatatagtcagtcctgaagacataatagaaaagtatggagctgacaca
gcaaggctgtttatactctttgctgcaccgccagagagagatttagagtggtcagaccaa
ggggttgaaggatgttttaggtttttaaataggctgtggagactttatatagaacttaaa
aacaaacttgcagatgataatcttgttggtgagtctgaacttgatgatgagctaagatat
agattaaattatacaattaaaaaggtcacagaggatataggggaaaggttcaattttaac
actgctatcagtactatcatggaacttttaaatttcttgtatgaatataaggaaagtgga
aaattaaacaaagatttaattatagatacactcaggaatttattaatattgatttatcca
tttacacctcacattgcatgtgagctatgggaggttatggggtttggtgaggacattgaa
gaggtaagctggcctcagtatgatgaagctgctcttgttcgaaagaatgtagaaattgct
attcaggtaaatggcaaggtaaggtcaaggatgaatatctctgtagatatgaccgaagat
gaagtaaaacaggcagttttgaatgaccaaaaactgaaatcacttttggatggaaaagaa
attgtgaaatttgtgtacgtgaaaaatagacttgttaacatcgtggtgaaataa

DBGET integrated database retrieval system