KEGG   Caldicellulosiruptor owensensis: Calow_1050
Entry
Calow_1050        CDS       T01347                                 

Definition
(GenBank) ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Calow_1050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cow03011]
    Calow_1050
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_1050
Ribosome [BR:cow03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Calow_1050
  Bacteria
    Calow_1050
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_1050
SSDB
Motif
Pfam: Ribosomal_L32p DZR Zn-ribbon_8 DUF1272 HypA zinc_ribbon_2 Zn_Tnp_IS1595 zf-NADH-PPase Zn_ribbon_SprT
Other DBs
NCBI-ProteinID: ADQ04613
UniProt: E4Q154
LinkDB
Position
1136666..1136842
AA seq 58 aa
MAQPKRRWSKQRTHKHRANWKLEIPNLTECPQCHEMKLPHRVCPNCGYYRNRKVVNQD
NT seq 177 nt   +upstreamnt  +downstreamnt
atggcacaaccaaaaagaagatggtcaaaacaaagaacacataaacatagagcaaattgg
aaattggaaattccaaatcttacagagtgtccacagtgtcatgagatgaaacttcctcac
agggtatgtccaaattgtgggtattacagaaatagaaaagttgtaaaccaagactaa

DBGET integrated database retrieval system