KEGG   Caldicellulosiruptor owensensis: Calow_1188
Entry
Calow_1188        CDS       T01347                                 

Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calow_1188
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cow01007]
    Calow_1188
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cow03016]
    Calow_1188
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_1188
Enzymes [BR:cow01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Calow_1188
Amino acid related enzymes [BR:cow01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Calow_1188
Transfer RNA biogenesis [BR:cow03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Calow_1188
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_1188
SSDB
Motif
Pfam: HGTP_anticodon tRNA-synt_2b HypA C1_2 zinc-ribbons_6 DUF1272
Other DBs
NCBI-ProteinID: ADQ04746
UniProt: E4Q1L2
LinkDB
Position
complement(1273502..1274806)
AA seq 434 aa
MVTMDEIVALCKRRGFIFQSSEIYGGLNSCWDYGPLGVEMKNNIKRLWWKANVQLRDDVV
GLDSSILMNPKVWEASGHLSNFADPMADCKVCKKRWRTDQLQEYKCPECGGELTEARMFN
LMFKTFMGPVEEESAVVYLRPETAQGIFVNFVNVQQTMRKKLPFGIAQIGKSFRNEITPG
NFIFRTREFEQMEIEYFVKPGTDDYWHRHWIDQRINWYYKLGIRKENLRIREHGKDELAH
YAKACVDIEYLFPMGWSELEGIANRTDFDLTQHQKYSGENLTYFDDETKQRYIPYVIEPS
AGVDRSLLAFLIDAYEYQQIDKDDFRVVLHLHPAIAPIKAAVFPLLKKEELVKKAKEIYN
ELKYKWIVQYDESGSIGKRYRRQDEIGTPFGITVDYQTLEDETVTIRDRDTMEQVRVHIK
EIISYLEERIEVKF
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggtgacaatggatgaaatagttgccctttgcaaacgtcgaggatttatattccaatca
agtgagatatacgggggactcaatagctgctgggactatggtcctcttggtgtagagatg
aaaaataacataaaaagactgtggtggaaagcaaatgtccagctaagagatgatgttgtg
ggacttgattcaagtattttgatgaacccaaaggtgtgggaagcaagtgggcacttgagt
aattttgccgaccctatggctgactgcaaggtgtgcaaaaaaagatggagaacagatcag
ttacaagagtacaaatgtcctgagtgcggcggtgaacttactgaggcaaggatgtttaat
cttatgttcaaaacatttatgggtcctgtggaggaagagtcggcagtagtatacttgaga
cctgaaacagcacaaggtattttcgtaaattttgtaaatgtacagcagactatgagaaaa
aaacttccgtttgggattgctcaaatcggtaagtcgttcagaaatgagatcacccctggc
aattttatcttcagaacaagagagtttgaacagatggaaattgaatattttgtaaaacca
ggaacggatgattactggcacagacattggattgaccagagaataaactggtattacaaa
ctgggaataaggaaggaaaacttgagaattcgagaacatggtaaggatgagcttgcacat
tacgcaaaggcgtgtgtggatattgaatatttattcccaatgggatggtctgaacttgaa
ggtattgcgaacaggaccgattttgatctaacacaacatcaaaaatacagtggagagaac
ttaacatattttgacgatgaaacaaaacaaaggtatattccatatgtaattgagccatct
gcaggtgttgacaggtctttacttgcatttttgattgatgcatatgaataccagcagatt
gataaagatgattttagagtggtacttcaccttcatccagcaattgcacctataaaagct
gcagtatttccgcttctaaaaaaagaagaacttgtaaaaaaggcaaaggaaatttacaat
gaacttaaatacaagtggattgttcaatacgatgagagtggtagcataggtaaaagatat
agacgtcaagatgagataggaactccatttgggattacagtagattatcaaactttagaa
gatgaaactgttacgataagagatagagataccatggagcaagttagggtgcatataaaa
gagataatttcataccttgaagaaagaattgaggtaaagttttaa

DBGET integrated database retrieval system