KEGG   Caldicellulosiruptor owensensis: Calow_1190
Entry
Calow_1190        CDS       T01347                                 

Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
cow  Caldicellulosiruptor owensensis
Brite
KEGG Orthology (KO) [BR:cow00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cow03009]
    Calow_1190
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_1190
Ribosome biogenesis [BR:cow03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Calow_1190
 Prokaryotic type
  GTPases
   Calow_1190
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_1190
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N Dynamin_N GTP_EFTU RsgA_GTPase AIG1 Ras PduV-EutP MMR_HSR1_Xtn Roc AAA_22 ABC_tran
Other DBs
NCBI-ProteinID: ADQ04748
UniProt: E4Q1L4
LinkDB
Position
complement(1275601..1276503)
AA seq 300 aa
MAFKSGFVALIGRPNVGKSTLMNYLVGKKISIISPKPQTTRNSIKGILTLEDAQIIFIDT
PGVHPPKNKLGEYMVKVSEKTLKEVDLILYIVEAIDNGIGPWDEAIVEKLKEVETPKILV
LNKSDLASKENIEVLKSIFSAKLNFESIIDIAAINGYNCDLLLNEIKELLPEGPKYYLDD
MTTDVRESFIVAEIIREKILLNLSEEVPHGVGIAIERFAERENKDILDIEAIIYCEKDSH
KAIIIGKGGQMLKKIGMQAREELEMIFGMKVNLQLWVKVKKNWRDDISAMKMLGYNLKEV
NT seq 903 nt   +upstreamnt  +downstreamnt
atggcattcaaatccggatttgttgcgttaattggtcgtcctaatgttggtaaatctact
cttatgaactaccttgttggtaaaaagatctctattatttctcccaaaccacagacaacc
agaaacagtataaaaggtatcctcacattagaagatgctcagattatattcatcgacaca
ccaggtgttcatcctccaaagaacaagcttggcgagtatatggtaaaggtatctgagaag
actttaaaagaagtagatttaattttatatattgtagaagcaattgacaatggaattgga
ccatgggatgaagcaatagtagaaaagttaaaggaagtggagactccaaagattctggtt
ttgaacaaatctgaccttgcttcaaaagaaaacatagaggtactaaaaagtattttctcc
gcaaaactgaattttgaatctataattgacatagctgcaattaacgggtacaattgcgac
ctgcttcttaacgaaataaaggagctgcttccggaagggccaaagtattatcttgacgat
atgacaactgatgtgagagaaagttttattgtagcagagattataagagaaaagattttg
ctcaatctttctgaagaagtaccgcacggcgttggaattgcaattgagaggtttgcagag
agagaaaacaaagatatactggatatagaggcaatcatctactgtgaaaaagattcgcac
aaagcaataattattggtaaagggggacaaatgcttaagaaaattggtatgcaagcacgg
gaagagcttgagatgatatttggaatgaaagtaaatcttcagctttgggtaaaagttaag
aaaaactggagagatgacatctctgccatgaaaatgctcggttataaccttaaagaggtc
tga

DBGET integrated database retrieval system