KEGG   Caldicellulosiruptor owensensis: Calow_1757Help
Entry
Calow_1757        CDS       T01347                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00040  Pentose and glucuronate interconversions
cow00051  Fructose and mannose metabolism
cow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calow_1757
   00051 Fructose and mannose metabolism
    Calow_1757
Enzymes [BR:cow01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Calow_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N PrmA UDPG_MGDP_dh_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ADQ05293
UniProt: E4Q4L4
LinkDB All DBs
Position
complement(1838733..1839773)
Genome map
AA seq 346 aa AA seqDB search
MGTMKAIVLEKPKVLKMEIRDRPVIADDEVLVAVKCVGICGSDVHYYEHGRIGRYVVEKP
LILGHEASGEVVSVGKNVKKFNIGDRVVIEPGRTCGKCEYCKNGRYNLCPDVKFLATPPV
DGALCEYLAVREDYLFKVPNDVDYDIATLVEPLSVGIHGAMRGNVKVGDKVLILGLGPVG
LLTILAVKAFGASQVIAVDVQPLRLEAAKELGATHVINAKESNYKQLILEATGNTGPDIT
FETAGSKDTNKIAFEITKRGGRIVLIGLLAESEVPVNINSVVDNEYNVYGVFRYANTYNK
AIEVLSSNLEKAKKLVTHRFKLDEAAQAFEFVRENKDKCIKAVIVI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgatgaaggctattgtattagaaaaaccaaaagttttaaaaatggaaataagg
gatagacctgtaattgcggatgacgaagtattagttgctgtcaaatgtgtagggatttgt
ggttctgatgttcattattatgaacatggtagaataggtagatatgttgtagaaaaacca
ttgattttaggtcatgaggcaagcggagaagttgtcagtgtagggaaaaatgtaaaaaaa
tttaatattggagatagagtggttatagaacccggaagaacatgcggaaaatgtgaatat
tgcaaaaatggacgatataatctatgtccagatgtaaagtttttggctacaccacctgtt
gatggagcactgtgtgagtatttagctgtaagagaggattatttgtttaaggttcccaat
gatgttgattatgacatagcaactttggttgaaccactgtcagtaggtattcatggcgct
atgcggggaaacgtaaaagttggggacaaagtattgattttaggattgggaccggtgggt
ttgttgaccattttggcagtaaaagcgtttggagcaagtcaagtaatagcagtagatgtt
cagcctttgaggttagaggcagcaaaggaattaggagcaactcatgtcataaatgcaaaa
gagagcaattataagcaattaatacttgaagcaactgggaatactggtccagatataact
tttgaaactgcagggtctaaagatacaaataaaatagcctttgaaataacaaagcgcggc
ggtagaatagtccttattggtttattggcagaaagtgaggttccagtaaatataaattct
gttgtagataacgagtataacgtttatggtgtttttagatatgcaaatacttataacaaa
gctattgaggttttatcaagcaatttagaaaaagctaaaaaactagtaactcataggttt
aaattggatgaggctgcacaagcttttgaatttgtaagagaaaataaagataaatgtata
aaagcggtgattgtcatataa

DBGET integrated database retrieval system