KEGG   Caldicellulosiruptor owensensis: Calow_1783
Entry
Calow_1783        CDS       T01347                                 

Definition
(GenBank) ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Calow_1783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cow03011]
    Calow_1783
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_1783
Ribosome [BR:cow03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Calow_1783
  Bacteria
    Calow_1783
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_1783
SSDB
Motif
Pfam: Ribosomal_S6 E2_bind
Other DBs
NCBI-ProteinID: ADQ05317
UniProt: E4Q4V7
LinkDB
Position
complement(1882722..1883012)
AA seq 96 aa
MVERKYETVFIISPTLDDEARANLIEKFKNLISSNGQLLTVEEWGKKRLAYKIDKHAEGY
YVLMQFISKPEFPRELERVYRITDGVIRFLTVKLEK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggttgagagaaagtatgaaacagtatttataattagccccacacttgacgatgaggca
agagcaaacctcatagagaagttcaaaaaccttatctcaagcaatggacagcttcttaca
gttgaagagtgggggaagaaaaggcttgcgtacaagattgataagcacgcagaagggtat
tacgttctgatgcaatttataagcaagcctgagttcccgcgcgagcttgagagggtttat
agaattacagatggggttatcaggttcttaactgtaaagcttgaaaaataa

DBGET integrated database retrieval system