KEGG   Cupriavidus oxalaticus: E0W60_22490Help
Entry
E0W60_22490       CDS       T06004                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
cox  Cupriavidus oxalaticus
Pathway
cox00020  Citrate cycle (TCA cycle)
cox00190  Oxidative phosphorylation
cox00650  Butanoate metabolism
cox01100  Metabolic pathways
cox01110  Biosynthesis of secondary metabolites
cox01120  Microbial metabolism in diverse environments
cox01200  Carbon metabolism
Module
cox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cox_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cox_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E0W60_22490 (sdhC)
   00650 Butanoate metabolism
    E0W60_22490 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    E0W60_22490 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: QBY53814
UniProt: A0A375G164
LinkDB All DBs
Position
2:complement(2508036..2508446)
Genome map
AA seq 136 aa AA seqDB search
MAEAVKQARPEFRNIGISQIAKYRLPWAGKVSILHRVSGALMFLLLPFVLYLFEQSITSE
LSFAKFSALLSGGFVKLVVLALIWGYLHHFCAGIRFLLLDVHVGVSKPASAKSAISVLVV
SLLLTLIFGLKLFGLF
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagccgtcaaacaagccaggccggagttccggaatatcggtatctcgcagatc
gcgaaataccggttgccctgggccggcaaggtatccatcctgcatcgcgtgagcggtgcc
ttgatgttcctcctccttcccttcgtcctgtacctgttcgagcagagcattacctccgaa
ctgagcttcgcaaagttctcggccctgttgtccggcggctttgtcaagctggttgtgctg
gccctgatctggggttatctgcatcatttctgcgccggtatccgctttctgctgctggat
gtgcacgttggtgtttccaagcccgcctcggccaagtctgccatcagcgtgctggttgtc
agcctgctgcttaccctgattttcggcctgaagctgttcggcctgttctga

DBGET integrated database retrieval system